iOS app Android app

Mary Ellen Harte
GET UPDATES FROM Mary Ellen Harte
Mary Ellen (Mel) Harte Ph.D. is a biologist who writes on climate change and population issues. She co-authored the free downloadable book, Cool the Earth, Save the Economy, at Cool the Earth, and produces the weekday "Climate Change Report," 90-second audio newscasts, as well as the Climate Change Reports blog.

Entries by Mary Ellen Harte

Climate Change This Week: State of the Climate, Solar Rise, and More!

(0) Comments | Posted January 26, 2015 | 3:07 PM

Today, the Earth got a little hotter, and a little more crowded.


OO A "Cheesy Love Story" : The Fun Ad Doritos Doesn't Want You to See - palm oil is bad for people and our carbon-storing rainforests. It's in Doritos.

Related Headline:

OO Fake Doritos Ad Pressures Pepsi Over Palm Oil Policy

* * *

The State of the Climate

Takeaways:

* Our global "water insurance," glaciers, are melting away.

* Sea level rise: 8 inches over past century -- now, rising much faster.


"The Fuse is Blown":
Glaciologist's Jaw Dropping Account of a Shattering Moment

Eric Rignot co-authored a paper last spring showing that large areas of the West Antarctic Ice sheet are now in "irreversible decline" -- think irreversible sea level rise....

* Things are changing FASTER than the science predicted.

But we can act to address this fast - the solutions are relatively cheap!
Will you be part of the solution?

2015-01-26-oddsthathottestrecordedyearssince2000arenotrandomwarmingvariationccr261.png
Just how likely is global warming man-made, not random variability?

OO Go Figure: Figuring the Odds of Earth's Hot Streak of Years - by statisticians on the warming being random, rather than man-made.

OO EPA Plans Oil and Gas Methane Emissions Cuts - up to 45% by 2025 (from 2012 levels) Well, that will hack away at a future source ... but what about present sources from fossil fuel operations - and from the tundra due to global warming?

SOLAR KEEPS RISING

2015-01-26-solarkeepsrising500solarsunrise.jpg

OO Solar Power On The Rise - As the cost of solar power continues to fall, the market booms worldwide: in many parts, it is now cheaper to produce solar power than fossil fuel or nuclear energy

2015-01-26-solarpvconstructionworldwideccr261.png

OO USA: Solar Is Cheaper Than the Grid
in 42 of the 50 Largest Cities
- and in almost all of them, solar is a better investment than the stock market.

Related headline:

OO Report: Forget Stocks, Invest In Solar Panels

2015-01-26-solarjobs620xsourcewww.popularresistance.orgccr261.jpg

OO Solar Is Adding Jobs 20 Times Faster Than the Broader Economy


Related Headline:

OO The Solar Industry Created More Jobs In 2014 Than Oil And Gas Extraction

2015-01-26-rooftopsolar310_200SourceGreenTechMediaccr261.png

OO US South Goes Solar:
Bipartisans Support Solar Spread in Florida & Georgia
- from tea partyers to liberals.

2015-01-26-Solarhomesale310xresaleSourceGreenTechMediaccr261.jpg

OO Host-Owned Rooftop Solar Improves a Home's Resale Value - says a new study.

OO CA: Another Big 550MW Solar Farm, Desert Sunlight, Goes Online - as California adds solar capacity in half-gigawatt chunks.


OO US SunEdison Plans $4B Solar Factory, 5GW of Projects - In India

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2015-01-26-uselessenergycutasthmaccr261.png


OO Save Energy --> Cut Pollution --> Cut Children's Asthma - is the message that really works to get people to cut home energy use, says a UCLA study.

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO US Produces More Wind Power Than Any Other Nation President Obama said in his 2015 State of the Union address, notes the Power of Wind team at the American Wind Energy Association. We also make the most productive wind turbines, but all that is threatened by the recent cut of the federal Production Tax Credit in Congress.


OO Americans Getting More Serious About Global Warming As A Priority - says a new Pew Poll, but at 22nd place in the list of 23 top policy priorities, you might wonder how - 38% of those polled put it on the list, however, and that's a popup of almost 10% from last year.

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Maine: Green-Energy Inspiration Found on a Danish Island - Maine's Monhegan stands to learn from the Danish energy-independent island of Samso.

OO California Takes Lead In Developing Energy Storage - mandating enough stored energy in its utilities to power 1 million homes.

OO US Automakers Keep Rolling Out Electric Vehicles


2015-01-26-ChinatrafficBeijingWikipediaccr261.jpg
The many, many reasons why China is cutting subsides for polluting non-electric cars. Wikipedia

OO China to Cut Subsidies for Non-Electric Vehicles

OO Soon 80% Of Canada Could Have A Carbon Price


OO Mines Worldwide Becoming Important Market for Renewables - both as providing solar/wind power sites on deserted lands, and powering current operations with clean renewables.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO Poland's Shale Gas Revolution Evaporates In Face Of Protests


OO W VA: Facing Backlash, Board Of Education Votes
For an Accurate Climate Change Curriculum

2015-01-26-pipelineprotestmar22014.jpg


OO Activists Rally Across USA: Call On White House To Reject Keystone XL


OO Religious Activists Tell Republicans To Get Religion On Climate Change

Insights:

2015-01-26-peatswampinMalaysianBorneomongabayccr235_resize.jpg
Mongabay

OO Drying And Burning Peatlands Amplify Global Warming

Good Ideas:

OO Biggest Energy Innovation? Go Without - energy efficiency is the invisible fuel.

OO Making Bike Sharing Part Of Public

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies:

OO New - And Worrisome - Contaminants Emerge
From Oil And Gas Wells
- two new hazardous fracking waste chemicals - ammonium and iodide - are pouring into Pennsylvania and West Virginia waterways, a new study shows.

OO Who Needs Lobbyists?
Big Energy Spends Big Ad Bucks To Win American Minds

OO Fracking Plays Dirty - fracking sand companies in Wisconsin are asking to be annexed to cities so country regulations don't stop their growth.

2015-01-26-rateatwhichtheworldburnsoilccr261.png

OO Burning Oil : 2.7 Million Gallons A Minute and Rising - Global oil consumption has never been higher and is rising.

OO Canada: 230,000 People With No Drinking Water After Diesel Spill


2015-01-26-biomasspollutionccr261.jpg
Biomass burning emits greenhouse gases, and is how America is legally burning its carbon-storing forests: turning them into wood pellets and exporting them to European fireplaces.

OO EPA Gives Green Light to Biomass Pollution - a bad idea, made worse when people start defining carbon-storing forests as "biomass." Burning biomass emits greenhouse gases.

Even more emissions occur when OO Biomass Industry Plays With Fire and gets burned.

Related Headline:

OO UK: 'Green' Biomass Boilers May Waste Billions In Public Money

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png
Even elephants can't survive on oil. Credit: Mary Ellen Harte

OO House Passes Sneaky Bill
Attacking Public Health and Environmental Regulations


*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-26-anomaltempjan252015.png

Daily Climate Change: Global Map of Unusual Temperatures, Jan 25, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

2014-07-06-populationmatters2green.png

Nature's Breaking Points: Humanity Has Crossed 4 Out Of 9 'Planetary Boundaries' says a new study, reports Joel Achenbach at the Washington Post, beyond which we are destabilizing our environment and creating an unsafe future for humans in coming decades. The crossed boundaries are the extinction rate, deforestation, atmospheric CO2 levels, and the flow of nitrogen and phosphorous into the oceans.

Although the paper mentions our exploding populations, the authors miss that for what it is: the most obvious crossed boundary of all, and the main force pushing us beyond other boundaries.

2015-01-26-additionaldeathsannuallyfromglobalwarmingsaysWHOccr261.png
An array of human ills, from allergies to depression will increase in a warming world and cause additional deaths, says the World Health Organization.

OO Seven Ways Climate Change Could Really Kill You include allergies, heart attacks, salmonella outbreaks, depression, malaria, diarrhea, heat exposure and malnutrition, all of which will increase as the world warms further, the World Health Organization warns.

Natural Repercussions:

OO Global Warming Linked To More Extreme Weather And Weaker Jet Stream - more directly than ever.

2015-01-26-StatueOfLibertyWavesourceCitizenOfEarthatDailyKos.jpg
Source Citizen Of Earth at DailyKos

Sea Levels Rising Much Faster Than Previously Thought says a new study, reports Seth Borenstein at the Sacramento Bee via AP. The study uses a new method showing that the rise during much of the 20th century was actually underestimated by about 30% -- that is, the rise was slower.

But that means the rise since 1990 to present must be actually far faster to account for current levels. So, the current rise is much faster than previously estimated. Oh-oh.

Related Headline:

OO Sea Level Rise Accelerating Faster Than Thought

OO Earth's Fresh-Water Resources At Risk says a new study.

2015-01-26-hialtitudesouthwestconiferforestinGrandCanyonNPCreditParkWilliamsLamontDohertyEarthObservatoryccr261.jpg
High altitude forest in the Grand Canyon National Park. Credit Park Williams, Lamont Doherty Earth Observatory

Dry Skies Literally Drying Out And Threatening US Southwest Forests reports John Upton at Climate Central, say researchers. Due to drought, the skies are holding so much less water than they could that it is creating a lack of vapor pressure, known as a vapor pressure deficit.

This ends up pulling moisture out of the high altitude southwest forests atop plateaus and mountains. This, added to decreased snowpacks and higher temperatures, is behind ever worsening wildfire seasons there, and increasing loss of forests.

OO Alarm Over Siberian Sea Permafrost Thaw, Methane Leak where a Russian gas company plans to drill - just west of the peninsula where a giant sinkhole was discovered last summer, probably created from methane escaping the melting permafrost.


2015-01-26-fishdieoffsourcewww.dcclothesline.comccr261.jpg
Source: www.dcclothesline.com

OO Mass Die-Offs Of Fish, Birds, Mammals Increasing - some of which are consistent with climate change.

OO 2014 Was The Warmest Year Ever Recorded On Earth

OO Perennial Arctic Sea Ice Continues To Shrink - threatening the planetary summer thermal shield.


Human Repercussions:

2015-01-26-droughtsignprayforrainsourcefacebookccr253.jpg
Source Facebook

OO CA: Drought Fears: Signs Of 4th Straight Dry Year - state and federal water officials sound the alarm, saying that more action will be needed to combat the continuing drought.

OO Los Angeles Basin: Far Higher GHG Methane Emissions Found

OO Fishing Industry Could Lose Up To $41 Billion Due To Climate Change says a new study.

2015-01-26-trematodeparasiticSchistosomawormWikipediaccr261.jpg
A parasitic trematode worm, magnified. Wikipedia

OO Another Reason To Fear Climate Change: You May Get Worms - parasitic ones, like the ones that invade your skin in the tropics.

OO Asia: Climate Change Plagues Nepal In The Himalayan Mountains as melting glaciers deprive it of needed hydroelectric power and change weather, threatening food crops.

OO Pakistan: Climate Change Turning Mountain Communities Into Soup of Hazards - as hotter temperatures that melt glaciers, and heavier rains create far more flooding.

2013-12-08-smog659pxBeijing_Forbidden_City_SmogacreditBrianJeffreyBeggerlyviawikimedia_resize.jpg
Smog over the Forbidden City in Beijing, China. Credit Brian Jeffrey Beggerly via wikimedia commons.

OO Airpocalypse Now: Beijing's Toxic Smog Soars Off Charts. Again.

OO Africa: Global Warming Foments Extremism in Boko Haram - contributing to the ongoing violence.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-26-deforestationinMalaysiaareahitbyespbadfloodingatMongabay.comccr261.jpg
Logging is widespread in Peninsula Malaysia, and in Malaysian Sarawak on Borneo Island.

OO High Deforestation Rates In Malaysian States Hit By Flooding

OO Sarawak Malaysia May Stop New Logging
After Much Deforestation And Corruption

2015-01-26-amazondevastationfromgoldmining500w.jpg

OO Amazon Gold Rush Destroying Huge Swaths Of Rainforest

OO Deforestation Climbing - Along With Fears - In The Amazon

2015-01-26-steakdinnerWikipediaccr261.jpg
The real price of that steak dinner? More climate change, and threats to your health. Try something deliciously green next time! Wikipedia.

OO Global Warming Driver: Rising Meat Consumption
Pushes Farming Past Deforestation
- says a new study.

OO Sulawesi Village Seeks Protection For Sacred Forest
Threatened By Development - it supplies their water and, yes, store lots of carbon.

OO Palm Oil Expansion May Play Role In The Ebola Crisis - as expansion into forests increases likelihood of transmission from wildlife to humans.

Good Conservation Ideas:

2015-01-26-treeclimbingCourtesyTimKovarinPortlandTribuneccr261.jpg
Courtesy Tim Kovar in the Portland Tribune

OO Tree Climbing As A Tool To Build Respect For Forests


OO Sulawesi, Indonesia: Farmers Help Restore Degraded Forests

OO Community Forest Management Attracts International Attention
In Sulawesi, Indonesia

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this stinging plant flower I photographed in Chile. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change: 2014 Hottest Yet, Oceans Threatened, Solar Trees, and More!

(4) Comments | Posted January 19, 2015 | 4:23 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-19-averageglobaltemperaturestimelineatthenytimesccr260.png

OO 2014 Breaks World Heat Record - both NOAA and NASA, federal US science agencies, agree it is the hottest year our planet has experienced since 1880, when records...

Read Post

Climate Change This Week: The Heat Is On, A Wind Power Tree, and More!

(1) Comments | Posted January 12, 2015 | 1:34 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-12-annualglobaltemperatureaverageaJapanMeteorologicalAgencyclimatecentralccr259.png
Japan Meteorological Agency is the first of 4 major global temperature recordkeepers to release their data for 2014, notes Brian Kahn at Climate Central.

OO 2014...

Read Post

Climate Change This Week: Foul Fracking Fumes, Solar Sponge, and More!

(1) Comments | Posted January 5, 2015 | 1:41 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Why the US China Climate Deal Is Real - because their rapid development of fossil fuels, particularly coal, has put them on a collision course with some very, very, hard physical limits - like water.

OO China Plans More Closures Of Coal Mines Through 2016 - closing 2,000+ this year, and limiting itself to 10,000 by 2016.

2015-01-05-FrackingnrschoolplaygroundcredBrookeAndersonatfractracker.orgccr253.jpg
Fracking wells occur all over, such as near schools -- or near you.
Credit: Brooke Anderson at fractracker.org

OO Fracking Fumes: Hazardous to Your Health - Emissions from oil-and-gas production threaten human health significantly. Immediate steps are needed to reduce exposure to the toxic pollution, says a new analysis of studies by by the Natural Resources Defense Council.

2015-01-05-bread2wikipediaccr257.jpg
Wikipedia

OO The Bread Threat:
Warming Will Reduce Wheat Production
, research shows.

2015-01-05-Pope_Francis_2013wikipedia.jpg Wikipedia

OO Pope Francis to Issue Climate Edict


SOLAR KEEPS RISING

2015-01-05-solarkeepsrising467solarpvsunrisesourceGreenTechMediaccr243.png

OO How I Chose to Pair My Solar System With an Electric Car

OO Net-Zero Communities Using Solar Power
Expand In Florida

OO Japan to Build World's Biggest Floating Solar Farm

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO 2014: 4 Key Developments in Distributing Clean Energy

* Germany's Top Utility Chucks Coal, Concentrates on Clean Energy

** Solar Power With Storage Becomes Competitive for a CA Utility

*** New York Plans a Large Scale System of Clean Energy Microgrids

**** Hawaii Demands a Solar, Wind Power Future With Energy Efficiency


OO Employment Drops All Over the Power Sector--Except in Renewables!


OO 2014 Saw Key Developments in Storing Clean Energy - with California making big strides, Tesla's Giga battery factory, and the breakout of new batteries.

The Best Things That Happened To Renewable Energy In 2014 reports Katie Valentine at Climate Progress include:

2015-01-05-solarroadsolarroadinNetherlandsccr257.png
The 230 foot long bicycles-only road will produce enough solar power for 3 homes. From acorns grow...
Solarroad

> World's First Solar Road In The Netherlands

<> Solar Power Efficiency Broke The 40% Barrier!

><> World's Largest Solar Plant Comes Online

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

> Scotland Was Totally Powered By Wind For A Month!

<> World's Largest Tidal Array Gets Green Light

><> World's Largest, Most Powerful Wind Turbine Comes Online

2015-01-05-Sunswiftsolarcarwent500kmupto85mphrecordccr257.jpg
Australia: university students built Sunswift, a solar car that went 500 km on a charge, with an average 87 mph speed - fast and far. Now, they're working on making it legal for regular roads. Sunswift

> Solar Car Hits Speed Record, Could Soon Hit The Streets

> Researchers Continue To Develop New Ways To Use Solar - from solar cloth to a solar sponge that can, researchers claim, convert 85% of solar energy into steam.

<><><><>

OO Washington State: Offers Ambitious Cap-and-Trade Plan - one of the most sophisticated and all-encompassing climate-pollution pricing programs.

OO Vermont Closes Nuclear Power Plant to Invest in Renewables

2015-01-05-commutingbybicyclewikipediaccr257.jpg
Already a fixture in some European cities, commuting by bicycle programs are starting to take off in the US. Wikipedia

OO Bicycle Commuting Programs Start Lowering US Emissions
and Enriching US Cities


OO Australia Records Biggest Emissions Drop in Decade
Due to Carbon Tax
- the bad news is that the new Prime Minister axed the tax. BOOOOO!

WHAT WORKS

Speaking Out:

2015-01-05-antifrackingphotoAPphotoMikeGrollccr257.jpg AP Photo/Mike Groll

OO New Yorkers Strongly Approve Of State's New Ban On Fracking

2015-01-05-sheldonwhitehouse50thviaclimateprogress.jpg
OO The Climate Action Senator:
Sen. Sheldon Whitehouse Pushes for Change In 83 speeches
- doing what no man has done before....


Informed Leadership:

OO Obama's Secret Love For Science

Good Ideas:

OO Regional Cap N Trade State Groups:
the Congress-free Climate Solution

*
*
*

WHAT DOESN'T WORK

Fossil Fuel Follies :

2015-01-05-fossilfuelmoney.jpg

OO Fossil Fuel Industry Spent $700+ Million During 2014 Elections - 10 times more than environmental groups.


OO Disused Oil And Gas Wells A Major Source Of Methane

2015-01-05-childrencleanupBangladeshoilspillinwetlandsanctuaryccr257.jpg
AP Photo

OO Barehanded Children Help Clean Up Massive Bangladeshi Oil Spill - in the world's largest mangrove forest, a protected sanctuary for a rare dolphin, as experts arrived to help.

OO World's Top 500 Firms' Greenhouse Gas Emissions Rise 3% from 2010 to 2013, far off the cuts urged by the United Nations to limit global warming, says a new study.

2015-01-05-DeepwaterHorizon_fire_20100421wikipedia.jpg
The massive oil spilled by Deepwater Horizon is replicated every two months on average in Russia. Wikipedia

OO A Deepwater Horizon Every 2 Months:
Constant Oil Spills Devastate Russia

2014-07-06-populationmatters2green.png

*
*

2015-01-05-pigfacegovernmentofAustraliaccr258.jpg
Source: Government of Australia

OO The Population-Pork-Climate Change Connection:
China's Massive Pork Appetite Raises Emissions
- via greenhouse gas emissions from its massive farms, and from the deforestation to plant soybeans, a pig feed. The bad news? Pork consumption is ever rising in China

*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-05-anomaltempjan042014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Jan 4, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the eastern US and the waters surrounding it, are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, continuing its long drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

OO Earth Could Lose Its Summer Thermal Shield by 2020 (yeah, in 5 years) say experts; an ice-free summer Arctic Ocean would significantly add to global heating, as dark waters absorb the heat from 24-hour sunlight that ice once reflected.

2015-01-05-coralreefscene1DanNortonMicronesia.jpg
Credit: Dan Norton

OO 'Doomed' Corals To Face Worst Bleaching In Decades - as a trade wind cycle winds down in the next few years, accelerating warming and ocean acidification. A recent UN report estimated that warming ocean climes, ocean acidification, and the resulting bleaching events will cost the world economy over a trillion dollars in various resources and services by 2100.

Social Repercussions:

OO UK: Almost 7,000 Properties To Be Sacrificed To Rising Seas over the next century with no compensation to owners, as it becomes too costly to protect them.

2015-01-05-mosquito01tigermosquitocreditJamesGathany_resize.jpg As climate warms, the mosquitoes that carry dengue fever spread ever farther afield. Credit James Gathany

OO Dengue Fever Could Spread to Europe say UN researchers, and expand in South America and Africa due to climate change and urbanization.

OO Malaysia: "Unusually Strong" Rain Causes Worst Flooding in Decades;
100,000+ Flee

OO Irreversible But Not Unstoppable:
The Ghost Of Climate Change Yet To Come


2015-01-05-floodinginPakistanSeptember2014K.M.ChaudaryAssociatedPressccr257.jpg
K. M. Chaudary/Associated Press

OO The Extreme Weather And Climate Events Of 2014 In 13 Photos meteorologically speaking, 2014 saw record heat, record snow, record flooding, record drought, rising sea levels and super typhoons -- and extreme climate events are expected to continue unless humans take action to reduce emissions.

2015-01-05-TwintornadoesJune162014Nebraskamashableattwitterccr257.jpg
These deadly twins devastated parts of Nebraska in June 2014. See the video here.
Mashable at twitter

OO U.S. Could See Damage Of $1.1 Trillion Through 2100
From Sea Level Rise, Storm Surge

OO Land-Based Ice Is Melting Faster Than Thought
-- Raising Sea Levels Faster, Too
- as in Greenland and Antarctic glaciers.

2015-01-05-shrimpplatterviawikipediawikimediacommons_resize.jpg
Research indicates that the wonderful flavor of shrimp decreases as the water in which they grow becomes more acidic. Wikipedia

OO The Taste of Climate Change Coming Soon: Yucky Shrimp - say researchers, who raised the bad tasting shrimp in acidified waters, like those that are expected to occur in the near future; the seafood economy is likely to suffer.

OO Acidic Oceans Threaten World's Mussels - and seafood palates.

California Dryin':

2015-01-05-roadkillbearfishermansdaughteratflickrccr256.png
Wildlife is getting killed as they cross roads more in search of scarce food in California. fishermansdaughter at flickr

OO California's Drought Is Threatening Its Wildlife as animals flee their homes and risk their lives in search of food.

OO Once Desert Springs Are Now Dry As California's drought continues.

2015-01-05-almondmarzipancandycrowbotatWikimediaCommonsviaFlickrccr257.jpg
Marzipan Memories Fading? Almonds are a key ingredient in marzipan. Crowbot at Wikimedia Commons

OO Water Source For Almonds In California May Run Dry - drying up the $11 billion boost to the state economy.

OO Lost California Rangeland Poses Greenhouse Gas Risk - as destruction from human activities replaces these carbon storage systems with ones that emit greenhouse gases

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-05-rainforestbirdscarlet_macaw_04RButler_resize.jpg
A beautiful inhabitant of Brazilian forests, the scarlet macaw. Rhett Butler/Mongabay.com

OO Brazil's Forests Threatened By 'Chainsaw Queen'
-- the New Agriculture Minister

OO Restored Forests Help Efforts Against Climate Change - conserving and expanding the world's immense tropical forests is the single most promising near-term strategy.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed at the De Hoop reserve in South Africa recently. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: No Forests -- No Farming, Divine Divestment, and More!

(1) Comments | Posted December 29, 2014 | 7:51 PM

Today, the Earth got a little hotter, and a little more crowded.

*
*

2014-12-29-ClimatechangexmascarolersbyNishantChoksiattheNewYorker12.22.2014ccr257.jpg

Climate-Change Christmas Carols - by Ethan Kuperberg in "Shouts and Murmurs" at the New Yorker caught my eye. Okay, I admit I haven't sung any...

Read Post

Climate Change This Week: Bishops Bugle, Latin Solar Salsa, the Price of Heat, and More!

(0) Comments | Posted December 23, 2014 | 12:59 PM

Today, the Earth got a little hotter, and a little more crowded.


@@ The 2014 IPCC Synthesis Report Video - informative, engaging...

OO Study: Hotter Days In US Mean Less Cold Cash - Days that averaged about 77 degrees ended up reducing people's income by about $5 a day when compared with days that were about 20 degrees cooler.

2014-12-23-droughtsignprayforrainsourcefacebookccr253.jpg

OO American Drought: California's Economic Crisis - recent storms are not going to end the 'worst drought in a generation' that is turning much of central California into a dust bowl, and bringing one of the richest states in America to its knees.

2014-12-23-popefrancisandbishopsAPphotoAlessandraTarantinoccr256.jpg
"We express an answer to what is considered God's appeal to take action on the urgent and damaging situation of global climate warming." Alessandra Tarantino/AP Photo

OO Catholic Bishops From Every Continent Call
For 'An End To The Fossil Fuel Era'

* * *

SOLAR KEEPS FLYING, RISING, SAILING, SMILING, SURFING,

2014-12-23-solarkeepssurfing2windsurfingatColvabeachsourcebeachesingoacomapr2012.jpg

OO Texas: Austin Aims for 950MW of Solar Along With Bold Distributed Energy Goals

OO First Solar Plans to Expand US Solar to All
with Community Solar Projects
- and has acquired a solar community project company to do so.

OO Distributed Generation Like Solar Will Double Globally By 2023 says a new report.

2014-12-23-sunwithsombrero.png

Latin America's Breakthrough Solar Year, reports Adam James at GreenTechMedia, is characterized by the fastest growing solar PV market in history. Chile dominates the solar boom, and has the largest merchant solar plant in the world. But the US Company SunEdison is scoring on the action as the major developer behind the boom... way to go, SunEd!

OO Australia Reaches 4GW Of Rooftop Solar PV

OO Solar Rises In Malaysia During Trade Wars Over Solar Panels

2014-01-31-geostellargetcleanenergy.png
* * *

GOOD CLEAN NEWS

2014-12-23-Copenhagen_at_nightRoei.tabakatWikimediaCommonsccr256.jpg
Copenhagen at night. Roei.tabak at Wikimedia Commons

OO Copenhagen Lighting The Way To Greener, More Efficient Cities - a growing wireless network of streetlamps and sensors is saving money, cutting the use of fossil fuels and easing mobility, part of its ambitious goal of becoming the world's first carbon-neutral capital by 2025.

OO Paying For A Healthier Planet - using green bonds to encourage Mexicans to save energy.

OO West Coast States Lead Electric Vehicle Adoption In U.S.

2014-12-23-Chinagreatgreenwallwww.care2.comccr256.jpg
OO Great Wall Of Trees Keeps China's Deserts At Bay a new study says of the massive belt of trees being planted across China's arid north.

OO China Is In A Genuine Retreat From Coal,
Says Ex Energy Secretary Steven Chu

OO Many Govts Now Embrace Zero Carbon Emissions By 2050 - in a historic first.


2014-12-23-goplogohalfgreenelephant220_resize.png

OO Poll: Half Of Republican Voters Back Limits On Carbon - something for the GOP Congress to remember in 2015.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:


OO Top Scientists To Media:
Stop Using 'Skeptic' To Describe Climate Science Deniers

OO 'We're Running Out Of Time':
Leading Climate Scientist Unveils Latest Numbers On Climate Change


OO Seattle Billionaire Steps Into Coal Fight - to fund a suit against the Dept of Interior on leasing public land for coal. He's Seattle Seahawks owner Paul Allen.

2014-12-23-localsprotestsouthernoregonpipelineMailTribuneJamieLuschccr256.png
Mail Tribune/Jamie Lusch

OO Oregon: Most Residents Speak Against Proposed Southern Gas Pipeline

OO 11 SenatorsTold EPA How To Make Its Carbon Rule
Cut Even More Power Plant Emissions

2014-12-23-ObamaonStephenColbertReportDec82014ccr256.png

OO Colbert Report: Obama Downplays Keystone Benefits, Highlights Drawbacks


OO Climate Change Should Be A Human Rights Issue announced the International Bar Associatio, able to be challenged in a court of law.

2014-12-23-endangeredgoldenrumpedshrewinEAfricaKenyacoastforestccr256.jpg
The endangered golden rumped shrew inhabits an endangered habitat, an east African coastal forest.

OO Greens Protest, And Company Backs Away
From Kenya's Rare Coastal Forest

OO Groups Call On World Leaders To Stop Incentives For Big Dams which often destroy communities, important habitat, and emit the potent greenhouse gas methane.


Insights:

2014-12-23-choicebetweenactionnoactionviaIPCCviaClimateprogressccr256.jpg
Humanity's choice (via IPCC): Aggressive climate action ASAP (left figure) minimizes future warming. Continued inaction (right figure) results in catastrophic levels of warming, 9 °F over much of U.S.

OO What We Learned About Climate Change In 2014, In 6 Charts - here are two of them, above and below; remember, often climate models underestimate the real effects... and the costs.

2014-12-23-droughtacrossplanetby20812100viaClimateProgressccr256.jpg
Palmer Drought Severity Index (PDSI) for 2080-2099 with business-as-usual warming. By comparison, during the 1930s Dust Bowl, the PDSI in the Great Plains rarely exceeded -3 (see here). Source: Cook et al. and Climate Progress.

* *

2014-12-23-globalweirdinginteractiveishereglobalweirding.ishereccr256.png
The beginning of the global weirding interactive - hint, hint: the spinning ball gets redder as time rolls on...

OO Here's What Will Happen This Century
If We Don't Do Anything About Climate Change
Via cool graphics and animation, Global Weirding helps summarize how the planet may change over the rest of the century, using the most reputable source of information, the latest IPCC report.

OO Greenland's Ice Sheet Shifts Could Speed Melt - the sheet's dynamics are changing, which could ultimately raise sea levels that much faster.


2014-12-23-methaneleakfromoceanflooruseastcoastccr256.jpg

OO Warming Ocean May Be Triggering Mega Methane Leaks Off Northwest Coast as methane that was trapped in crystalline form beneath the seabed melts and is being released. -- and fast.

See also:

OO 'Widespread Methane Leakage' From Ocean Floor Off US Coast

2014-07-06-populationmatters2green.png

OO Mainstream Media - Newsweek - Tackles Overpopulation:
222 Million Women Need Access to Contraceptives
- not just physical access with accurate information about their use and results, but cultural encouragement and freedom.

2014-12-23-orchidcollage550MEHccr245.png
Many orchids are now endangered or going extinct, as we destroy their special habitats.

As it is, our exploding populations are changing the climate and irreversibly extinguishing much of the beautiful tapestry of life on Earth, and our mega life support systems, our ecosystems.

* * *

WHAT DOESN'T WORK

The Legacy of Fossil Fuels, and Their Combustion:

"We have privatized profits and socialized costs"

Fossil Fuel Follies

2014-12-23-santaflyingthrupollutionccr256.png
Santa to Planet Earth: All You'll Get For Christmas Is More Coal - And Global Heat

OO Coal Demand Set To Break 9 Billion Tonne Barrier This Decade

OO Sloppy Fracking Practices Result In Large Methane Leaks

OO Florida Fracking: State Uilities Want You To Pay For It


<><><><>

OO Methane Still Belches From US's Old Oil And Gas Wells


OO As U.S. Cleans Up, It's Exporting More Pollution

2014-12-23-teslaelectricroadsterwwindturbineswikipedia.jpg
A Tesla electric roadster: it can be a lot dirtier than it looks, depending on how the electricity was generated. Wikipedia

OO Without Clean Electricity E-Cars Aren't Clean says a new study; electricity from coal makes them worse than regular gas cars.

OO The U.S. Energy Story: Not a Pretty Picture
A new interactive map of US energy production over the past 20 years shows the biggest growth has been in natural gas, nuclear and biofuels; 2 out of 3 spout carbon emissions....

Ignorance:

OO Most Americans Aren't Aware Of The Health Impacts Of Climate Change

Bad Ideas: Damning Big Dams

OO False Victories For Sustainability: Amazonian Hydropower - there is a rising backlash against the huge economical, environmental, and sociological costs dams bring.

OO Lao Hydro Dam To Seriously Affect Vietnam's Mekong Delta both agricultural and aquatic resources, experts warn.


Delaying Action:

OO Climate Accord Struck In Lima, But Key Decisions Postponed

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2014-12-23-anomaltempdec222014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Dec 22, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, where the drought continues.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions

2014-12-23-PerupotatoesimperiledbyclimatechangeMilagrosSalazarIPSccr256.jpg
Peruvian potatoes are imperiled by climate change. Milagros Salazar IPS

OO Climate Change Creates New Geography of Food

OO UN: Drought In Central America Has Pushed 2.5m People Into Food Insecurity

OO Climate Change In Nicaragua Pushes Farmers Into Uncertain World

2014-12-23-endangeredanimals4www.kidsdiscover.comccr256.jpg

OO Earth Faces Sixth 'Great Extinction' As a growing human population and climate change eats away vital habitats.

OO Peru's Melting Glaciers A Deadly Threat As Temperatures Rise - with up to 40% of ice lost, water is filling existing lakes to the brim and spawning hundreds of new ones.

OO Developing Countries Need A Lot More Investment To Adapt To Climate Change

2014-12-23-BeachwithpeoplesurfersSydneyAustraliaWikipediaCommonsccr256.jpg
Endless Summer Ending? The world's beaches are disappearing from human development and climate change. Wikipedia.

OO World's Beaches Being Washed Away Due To Coastal Development increasing, and ever higher sea walls to defend against fierce winter storms and rising sea levels, say two of the worlds' leading marine geologists.

OO Rising Sea Levels Could Make Florida Residents 'Climate Refugees'

OO Waters Warm, And Cod Catch Ebbs In Maine

2014-12-23-prawnsoupwculturedshrimpinVietnamThyKhueLyflickrccr256.jpeg
A special regional soup in Vietnam features the area's cultured prawns. Thy Khue Ly at Flickr

OO Under Current Practices and Climate Change, Aquaculture Boom Is Unsustainable

OO Australia: National Agency Warns Of '$1 Trillion' Natural Disasters Exposure

Nature's Repercussions:

2014-12-23-supertyphoonusaginearsPhilippinesNOAAccr256.jpg
Note that the size of super typhoon Usagi is as large as the Philippines. NOAA

OO Warm Ocean Waters Boosting Typhoons, Record Heat

OO Reindeer Populations Declining Due To Climate Change, study finds.

California Dryin':

2014-12-23-roadkillbearfishermansdaughteratflickrccr256.png
A casuality of the road. fishermansdaughter at Flickr

OO California Animal Deaths Spike On Sierra Roads As Drought Hits Habitat sending bears and deer especially loping across roads and highways this fall, apparently searching for scarce food.

OO California's Drought Probably Wasn't Caused By Climate Change - But Worsened By It indicates new research by the National Oceanic and Atmospheric Administration.

<><><><>

OO Storm Pounds CA, But To The Drought, Just A Spritz

OO California Needs 11 Trillion Gallons of Water to Recover from Drought - ummm, that's 11,000,000,000,000 gallons.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2014-12-23-AmazonrainforestRhettButlerccr256.jpg
Amazon rainforest canopy. Rhett Butler at Mongabay

OO Growth Of Forests May Not Be Keeping Pace With Rising CO2 Levels

OO Forest Conservation Tied To The Rights Of Indigenous Communities

OO Indigenous Communities 'Among The Very Few Best Protectors' Of Peruvian Amazon

2014-12-23-indigenousforestcommunityinPeruAchuarwww.pachamama.orgccr256.png
An indigenous forest community in Peru, the Achuar. www.pachamama.org

OO Deforestation Puts Cultural Survival Of Forest-Dependent Peoples At Risk

OO Indonesia: Huge Borneo Forest Swath To Be Destroyed By 'Sustainable' Company

2014-12-23-bambooinMadagascarRhettButleratMongabayccr256.jpg
Rhett Butler at Mongabay.com

OO Bamboo Could Help Fight Global Warming as a fast growing forest species that can store carbon and repopulate degraded forest, and be harvested for commercial use.

OO An App To Save 400 Million Animals which are essential to the health of the forests that nurture them. The app helps track poachers, traffickers.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Happy Holidays, Folks!

2014-12-23-DSCN1560a_resize.jpg...
Read Post

Climate Change This Week: New Solar Record, Murder, a Flying Donut, And More!

(0) Comments | Posted December 15, 2014 | 3:28 PM

Today, the Earth got a little hotter, and a little more crowded.

*
*

2014-12-15-orangutanmotherchildhuddledpetrifiedencasedbyhunterscredVierPfotenFourPawsRHOIRexAPccr255.jpg
Vier Pfoten/Four Paws/RHOI/Rex/AP

Palm Oil is Lethal for Mother and Child: This orangutan mother and five year old child huddled, petrified, as bounty hunters closed in...

Read Post

Climate Change This Week: The Munchkin Dilemma, Solar Cash Crop and More!

(3) Comments | Posted December 7, 2014 | 6:06 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-12-07-kidsfromtalltoshort300www.marymoody.com.auccr254.jpg

And They're All the Same Age! Not. But a new study indicates that El Nino, which is exacerbated by climate change, can stunt kids' growth. The grandmother of these kids,...

Read Post

Climate Change This Week: the Pepsi Hijack, Cooling Mirrors, and More!

(0) Comments | Posted December 2, 2014 | 2:35 AM

Today, the Earth got a little hotter, and a little more crowded.

2014-12-02-holdrenonletterman11262014ccr253.png

An Inspiring Conversation on Addressing Climate Change
National Scientific Advisor John Holdren on David Letterman , viewed here.

Takeaways:

There is a huge difference between...

Read Post

Holiday Football? Try Planetary Pinball!

(0) Comments | Posted November 26, 2014 | 2:42 PM

The Pinball Machine of Climate Change

2014-11-26-footballplayercatchesglobeEarthmehccr252.png

I know, I know, it's football season. Across America, millions are planning their Thanksgiving weekend TV football feasts and parties. But before you settle into the couch and start chowing down on...

Read Post

Climate Change This Week: Lightning Increasing, Solar Cloth, and More!

(0) Comments | Posted November 24, 2014 | 2:42 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-11-24-colbertpolarplunge7ccr252.png
Stephen Colbert takes the Polar Plunge here, highlighting the dim lights who don't understand how global warming can create both extremely cold and hot weather.

Read Post

Climate Change This Week: A BIG Climate Pact, Cheap US Solar Soon All Over, and More!

(1) Comments | Posted November 17, 2014 | 6:00 PM

Today, the Earth got a little hotter, and a little more crowded.


South Florida and Sea Level Rise - A Slow Motion Catastrophe - latest in the This Is Not Cool Series by Peter Sinclair.


2014-11-17-USChinaclimatepactmehccr251.png

OO U.S., China Reach 'Historic' Deal To Cut Emissions - it's a long overdue beginning, and no where close to what it needs to be, but for now, "China, I think this is the beginning of a beautiful friendship...."

SOLAR KEEPS RISING

2014-11-17-solarfactsmotherjonesccr251.jpg


Brazilian solar bids roll in at high volumes and low prices to supply solar power to the nation's electric grid, resulting in nearly a gigawatt of new contracts reports Seth Zuckerman at ClimateCast. Less than 10% of the many proposals could be accepted, all at less than 9 cents per kilowatt-hour.

2014-11-17-solarenergyriseinUSviamotherjonesccr251.png


Here Comes The Sun: America's Solar Boom - an energy analyst at Deutsche Bank came to a startling conclusion recently, reports Tim McDonnell at Mother Jones: By 2016, solar power will be as cheap or cheaper than electricity from the conventional grid in every state except three. That's without any changes to existing policy.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

OO Green Energy 'Creates More Jobs Than Fossil Fuels' study says.

OO Scotland Produced Enough Wind Energy To Power Every Home In October.


OO LEDs the Fast-Rising Heroes of Efficiency are becoming the affordable and more efficient replacements of compact fluorescent lights.

2014-11-17-cleanenergygridccr251.png


EU Plans 'Supergrid' To Boost Security, Renewables reports Paul Brown at the Daily Climate. The European Union, nervous about Russia cutting off gas supplies and keen to cut emissions by developing renewable energy sources, aims to link all 28 member states to one electricity grid.

* * *

WHAT WORKS

Speaking Out:

2014-11-17-realitydropicon361xclimaterealityprojectccr251.png

You Can Help Fight Climate Change with Reality Drop, a project by the Climate Reality Project, to combat the rampant online misinformation about climate change and its solutions, especially clean energy. It makes it easy for you spread the truth or combat the denial surrounding hotly debated articles in their comment sections. Like a good fight? Here ya go!

OO We Must Manage Climate Risks By Cutting Carbon Pollution,
Top Scientists Conclude

OO Australia: Yawuru Native People Camp Out To Oppose Fracking

2014-11-17-divestprotestsourcedailycollegianFlickrccr231.jpg Source dailycollegian/Flickr

Divestment Movement Growing Among NGOs, Cities reports Seth Zuckerman at ClimateCast. The Oregon Environmental Council shed its dirty stocks and invested in green companies recently. And 350.org's Fossil Free movement enlisted its 30th city worldwide (Orebro, Sweden) to divest its investment portfolio from coal and oil.

The movement is growing, with campaigns up and running in London and eight German cities, and Paris waiting in the wings. Nearly 200 institutions, managing an estimated $50 billion, have pledged to divest since 2011; the number of investment professionals offering fossil-free portfolios has increased more than 50% this year.

2014-11-17-votingccr242.jpg

Where Voters Made a Difference on Climate:

Although the 2014 US elections shifted control of Congress under to a group dominated by climate deniers, who profess to understand nothing about the science, the elections also saw climate change solutions becoming a voting priority, reports Seth Zuckerman at ClimateCast.

Fracking bans won in a Texas oil town, an Ohio college town, and in two of three California counties that voted on the issue. In the northeast, the voter elected Democratic Gov. Tom Wolf of Pennsylvania, who promised to bring his state into the Northeast's Regional Greenhouse Gas Initiative.

2014-11-17-frackingprotestmarch2014CAcapitalRaeBreauxontwitter.jpg Zack Malitz on twitter

OO Americans Are Voting For Fracking Bans -
They Don't Trust The Oil And Gas Industry

2014-07-06-populationmatters2green.png

Creating Sustainable Populations Humanely:


Educating by Entertaining on Population, Health: African Radio - a new soap opera radio series launched in Rwanda aims to engage people emotionally as it confronts taboo subjects and informs on reproductive health and fertility, reports the Institute for Reproductive Health.

2014-11-17-worldvasectomyday600pxwww.glamadelaide.com.au_resize.jpg Doing what's responsible and right for humanity and the planet: getting a vasectomy.

The Latest Climate Change Statement:
Webcast Your Vasectomy
and be counted among the heroes on World Vasectomy Day, which was on November 14th this year, reports Jason Plautz at the National Journal. The day is a worldwide celebration of a different sort of sacrifice: men who get vasectomies.

Learning More About Climate Change:

2014-11-17-climateeducationgettingthepictureinfoccr251.png

OO Getting the Picture: Our Changing Climate - a learning tool for students and educators.

Good Ideas:

OO A Web Vacuum That Sucks CO2 from Your Email - at gmail, by identifying all those 1,000s of old emails you have yet to clean out of your email box; storing them uses up energy. Check it out here.

OO Scientists Create First Detector
Of Fracking Contamination In Water
- they can trace leaks and spills of fracking fluids--and even detect their presence in treated water.

*
*
*

WHAT DOESN'T WORK

Fossil Fuel Follies:

2014-11-17-fracking375aoilfieldpumpjackscreditUniversityofTexasviaCPcctw96.jpg

OO US Energy Boom Might Be A Short One since the majority of the country's shale oil and gas reserves could prove too deep and too expensive to drill.

OO Cheap Oil Bad For Carbon Cuts -
And For Fossil Investment, Too

2014-11-17-oilrefinery486USmapfromearthjusticeccr251.png

How close does your family live to an oil refinery? It's a Matter of Health
Find out on this interactive map here. Earth Justice

OO Rich Countries Subsidising Oil, Gas And Coal Companies $88 Billion A Year

2014-11-17-USsubsidizesoilexplorationUKguardianinteractiveccr251.png
This is where the US is subsidizing exploration for oil we cannot afford to burn - the US, and Russia -- and Putin's buddies. To see where others are subsidizing this, go here:

OO How The G20 Subsidises Exploration For Fossil Fuel - Interactive

2014-11-17-babyconcernedbyAjsmen91atWikimediacctw90.jpg
Ajsmen91 at Wikimedia Commons

OO Air Pollution Exposure Can Drastically Increase
A Child's Chances Of Developing ADHD


2014-11-17-vegetablesfruitswikipedia.jpg
Wikipedia

OO Affordable Food or Cheap Gas? Choose One as food and fracking corporations fight for the same precious resource, water.

OO India: Air Pollution 'Cutting Crop Yields By Almost Half'

OO China's Reliance On Coal Costs Over 600,000 Lives A Year says a new study.

Clueless Leadership:

2014-11-17-pollutionfromcoalpowerplantsourceRTCCccr231.jpg Republicans do not want to regulate this pollution. Source RTCC

OO Senate Republicans Vow To Dismantle Carbon Emissions Rules

OO Climate Change Denier Jim Inhofe (R)
In Line For Senate's Top Environmental Job

OO GOP Election Rout Delivers Blow To US Leadership On Climate Change

Inadequate Action:

2014-11-17-extremeweatheracompositeUSAmeharte.png
Even capping warming at 2 C will not prevent even more extreme weather in the future many scientists now say - unless we move dramatically to cut emissions via a transfer to clean energy and greater energy efficiency.

OO Capping Warming At 2 C Not Enough To Avert Disaster, many experts warn.

OO Cutting Methane, Soot Not Enough to Tackle Warming

OO Australia 'Losing Out' On Renewable Energy Investment - renewable energy investments there has dropped by 70% in the last year, says the national Climate Council, as foreign investors go elsewhere because the government has no clear renewable energy policy.

Faith in Techno-Fixes:

OO Many Experts Now Say: Technology Can't Fix Climate Change

Not Speaking Out:

2014-11-17-Sushiplatterwikimediacommonschidorianofjapanviaflickr.jpg This could be a bittersweet memory decades from now, if we don't halt ocean acidification. chidorian of japan/Flickr

OO Censored: Acidification Tops List Of Important Stories Ignored By Media

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2014-11-17-anomaltempnov172014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Nov 17, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US switched suddenly to abnormally cold as a massive Arctic front moved in. This will happen increasingly often under climate change, as melting Arctic ice creates conditions that slow Arctic winds (the jetstream) and make their geographic patterns ever more wavy - with some of those big "waves" pushing Arctic cold deep into the US.

2014-11-17-droughtBrionesReservoir2jan52014cctw89.jpg
California reservoirs remain low as the drought continues.

Meanwhile US waters and the far north are experiencing warmer than normal temperatures, with Alaska warmer than Texas on some days. The eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Extreme Weather:

OO 2014 Will Go Down As Hottest In California's History

OO Heat,Drought Worsen Smog In California, Stalling Decades Of Progress


Social Impacts:

2014-11-17-Boychild500_receiving_treatment_after_Haiti_earthquakewikipedia.jpg
Wikipedia

OO From Bar Fights To Wars, Climate Change Will Make Us More Violent

OO Hostages Of Climate Change: Trapped Poor Populations - the range of climate change calamities projected by many scientists - from floods to heatwaves and rising seas -will take its heaviest toll on the poor.

OO US: 'Nobody Is Truly Ready' For Rise of Seas

2014-11-17-cornwitheredaatexas2013USDAatFlickrccr251.jpg
USDA at Flickr

OO China: Drought Ends Run Of Record Corn Harvests

OO UK: Drought And Flood Fears After Warm 2014

2014-11-17-beeEuropean_honey_bee_extracts_nectar.jpg

OO Climate Change Disrupts Bee's Pollination of Flowers - with increasing global temperatures to blame, says new research..

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

OO Peru Has Massive Opportunity To Avoid Emissions From Deforestation

2014-11-17-monkeyMalaysianmacaquecredRhettButlerccr251.jpg
A once rare malaria is on the rise in Malaysia as carrier monkeys, fleeing deforestation, encounter people.
Rhett Butler at Mongabay.com

OO Human Infections By 'Monkey Malaria' Increasing
As Forests Disappear


OO Central Africa: Chinese Companies Wreaking Environmental Havoc - as they exploit without oversight.


OO Reducing Tax Evasion Could Help Save The Amazon - through taxing already cleared, underused land, says a new study.

2014-11-17-treerootsmangoCreditAaronEscobarviaWikimediaCommonscctw96.jpg
Aaron Escobar via Wikimedia Commons

Brazil: Global Meat Demand Plows Up Vast 'Underground Forest' reports Autumn Spanne at the Daily Climate. Far more threatened than the Amazon forest, the vast lands of the Cerrado have deep roots that store vast quantities of carbon -- but industrial farming is releasing this fast.

YOU CAN ACT to protect our homeland:

From re-elected Iowa State Senator Rob Hogg (Facebook: "Climate Action Across America"):

If 400,000 people can march for climate action in New York City, we can get 100 people to contact every Congress person by phone, email, or in person:

urge them to oppose the Keystone "export" pipeline and to act on climate.

It is okay to contact their offices regularly, and to invite others to contact them - they need to hear from Americans about the growing support for climate action.

<<1>> Please tell them we already have too much greenhouse gas pollution in our atmosphere, and building Keystone would make it even worse.

2014-11-17-farmswateratriskfromkeystoneccr251.png
The Keystone XL Pipeline would sacrifice American farms and endanger our water, so that a foreign company could export oil. Is this fair?

<< 2 >> You can add that Keystone would:

sacrifice American farms and ranches through eminent domain
and endanger our water -
just to let a foreign company export oil.

That would be #BadForClimate & #BadForAmerica, so say #NoKXL.

<< 3 >> Tell them to help US Wind Power instead: urge them to extend the Wind Energy Production Tax Credit.

Then let Rob know that you did it.

Finally, Endorse the EPA Carbon Pollution Rules here << Comment Deadline December 1 >> and be sure to copy your Congressional representative and Senators.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this autumn tundra I photographed years ago. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Ikea Sells Solar, IPCC's Urgent Report, and More

(2) Comments | Posted November 10, 2014 | 1:26 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-11-11-Colbertrepublicansinspiringmessageonclimatechangeccr250.png
Screen capture of Facebook Timeline Photos
Stephen Colbert: The Republicans' Inspiring Message on Climate Change --
You, Too, Can Be a Non-Scientist! To see this hilarious video...

Read Post

Climate Change This Week: Coal's Creepy Cancer, Saving Capitalism From Polluters and More!

(2) Comments | Posted November 1, 2014 | 11:44 AM

Today, the Earth got a little hotter, and a little more crowded..... bwahahahahahaha!!!!!
Hmmmm.... Actually, this really IS scary....

2014-11-01-tempanomaliesforSept2014NASAccr247.jpg


Fossil fuels are turning our planet into a pretty scary Jack o' Lantern. Vote for clean energy leaders on...

Read Post

Climate Change This Week: Driving Fast n' FREE on Solar, Record Rising Seas, and More!

(2) Comments | Posted October 20, 2014 | 7:37 PM

The EV Revolution Is Here!

Takeaways:

2014-10-20-solarparkinglotsPeterSinclairvideoEVRevolutionccr247.png

If we covered the 800 million US parking spaces with solar panels,
the output would be three times the US transportation energy requirements.
We're wasting sunlight.

- notes Desmond Wheatley, CEO of Envision Solar

Build a network of solar powered charging stations,
Where cars can get recharged for free.

- is a goal of Elon Musk, Wunderkind CEO of Tesla.

2014-10-20-electricvehicleEVrevolutionfromSinclairvideoEVRevolutionccr247.png
A Nissan Leaf Ad: Electric cars can already go 257 miles on a charge, accelerate faster than regular cars, and cruise at 80 mph or more.

SOLAR KEEPS ZOOMING

2014-10-20-solarmoney.png

SolarCity Will Finance US Home Solar
To Make Rooftop Systems More Affordable
reports Jeff Spross at Climate Progress. Financing installations will overcome the hurdle of ownership costs. Its CEO predicts that such lease-like loans could be half of their new business by the end of 2015.

OO Florida: Thousands of Clean Energy Jobs at Risk - if state caves to pressure to gut energy efficiency goals.

OO Mexico: 250 MW of Distributed Solar Power to Be Developed

OO Australia Commissions 'Oceania's Largest' Solar Farm

OO Keystone XL's TransCanada Buys 3 Solar Plants from Canadian Solar; now all they have to do is transfer their product line completely to clean renewable projects, and clean up their tar sands mess... come on, TC (aka Tarry Calamity), you can do it!

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg


Raw Materials Are No Bar To Renewable Energy Future reports Seth Zuckerman at ClimateCast. Shifting world electricity production to renewable sources would reduce air pollution and require a manageable quantity, says a new peer-reviewed life-cycle assessment.

Such a transition would save $1.8 trillion over the next two decades, says a study by the Climate Policy Initiative, which also found that governments and taxpayers will bear the greatest financial risk if fossil fuel reserves are stranded underground.

2014-10-20-solarsunrise.jpg

This research follows a pair of studies by the International Energy Agency foreseeing that solar power--in a combination of photovoltaic and solar thermalplants--could supply more than a quarter of the world's electricity by 2050.

OO Efficiency Gains Over The Last Decade Saved More Energy
Than China or US Consumed In 2011
- and that's for just the advanced countries...

OO Besides Cleaner Energy, Renewables Are Much Greener to Build says a new study.

2014-10-20-teslaelectricroadsterwwindturbineswikipedia.jpg
Wikipedia

Americans' Cars Are More Fuel-Efficient Than Ever reports Katie Valentine at Climate Progress. Plus, electric vehicle sales are up in the U.S., and the percentage of Americans who drive to work is down. The EPA announced a new gas mileage record for US cars and trucks: 24.1 mpg! Although gains are slowing as more people own SUVs and trucks.

2014-10-20-nobelprizemedalccr247.jpg

OO The Inventors Of A 'Revolutionary' Climate Solution
Just Won A Nobel Prize


OO CA's Drought Cuts Hydropower By Half
But Wind, Solar Help Fill the Gap

OO Northern Chile Has Top Renewables Market

WHAT WORKS

Speaking Out:

2014-10-20-flyfishingPeterforsythatwikimediacommonsccr247.jpg
Peterforsyth at Wikimedia Commons

OO Hundreds Of Hunting And Fishing Groups
Speak Out For Action On Climate Change

2014-10-20-LEGOShellOilprotestcontestmyslogangreenpeaceccr234.png


OO Greenpeace Sinks Lego's Deal With Shell Oil Over Arctic Drilling - which included having toddlers get their plastic cars "filled" at Shell Gas stations... makes your heart curdle, just thinking about it...

OO Glasgow Becomes First University In Europe To Divest From Fossil Fuels

2014-10-20-nobelprizewinnersonsustainabilityccr247.png

OO Nobel Laureates Call For A Revolutionary Shift
In How Humans Use Resources

2014-10-20-climaterainbowacrucifixccr227.png

OO Australian Anglicans Join Divestment Movement

OO Orange Country, CA: Growing Numbers Call for End to Fracking in GOP Area


Good Ideas:

2014-10-20-unbalancedscalesgr400wikipedia.png

International Lawsuits Could Punish Carbon Emitters
Even If Governments Don't
reports Jeff Spross at Climate Progress. Improving climate science and the workings of international litigation could make courtrooms the next climate change battlefield, according to a new report.

OO We Can Meet 2C Climate Target,
But Success Depends On Immediate Action
say energy experts.

2014-10-20-supersavingswhenyouactonclimatechangenowccr236.png

OO Americans Can Save More Money By Not Burning It on fossil fuels, says a new study, through energy efficiency and accelerating a switch to clean energy - or pay far more later from ever worsening climate catastrophes.


New Insights:

2014-10-20-FTFmoresigns500ofchangefromthegrandrapidfloods04.26.2013575514_507190535995687_1895225914_n_resize.jpg


OO Sea Level Rise Over Past Century Unmatched In 6,000 Years says study.

OO NOAA: Record Antarctic Sea Ice Growth Linked To Its Staggering Loss Of Land Ice as the freshwater flow from melting glaciers lowers the freezing temperature in the surrounding sea.

YOU CAN ACT

2014-10-03-voteforcleanenergyleadersccr245.png

Be A Climate Voter November 4 - the most important things you can do right now to promote climate action are register, vote, volunteer, and speak up publicly as a climate voter.

Please let candidates and the news media know that you are looking for candidates who will support climate action.

Speaking up makes a big difference. As one elected state senator notes,
"it is always reassuring to me as an elected official when my constituents tell me they support my work to promote climate action and sustainability, and it encourages me to do more.." Iowa State Senator, Rob Hogg.

Volunteer at a "climate voter" effort: the League of Conservation Voters, NextGen Climate, Climate Hawks Vote, and Vote-Climate.

Great March for Climate Action - a cross-country march from Los Angeles to Washington, DC, to support climate action - is now in Pennsylvania and scheduled to arrive in Washington, DC, on Saturday, November 1. You can join at any point for however long -- go here for details.

EPA Carbon Pollution Rules - Please Comment: Many groups are collecting signatures and comments in support of these rules; you can send comments directly to the EPA here.


Join the Citizens Climate Lobby.

2014-10-20-votingccr242.jpg

Pledge to VOTE here, then

MAKE A PLAN TO VOTE so that the daily demands of life doesn't sidetrack you. Here's a checklist to help:
* What time of day are you planning to vote on Tuesday, November 4th?
* How are you planning to get to the polls?
* Are you planning to bring the kids with you? Yes / No

Thinking through your plan to vote now makes it more likely that you'll vote on Election Day.
Need info on where you should vote? Go here.


WHAT DOESN'T WORK

Fossil Fuel Follies:

2014-10-20-smokestacksbehindhousesPeterEssickDec2013yale360climatechangephotoessay.jpg
Your dollars, going up in smoke, bringing you pollution and climate change.
Peter Essick

OO Bank of England Governor: Most Fossil Fuel Reserves Can't Be Burned - so coal, gas and oil assets are at risk of economic collapse.

OO Biomass Energy: Another Type of Climate Change Denial

2014-10-20-methanehotspotatthe4cornersNASAJPLCaltechccr247.jpg

US Methane 'Hot Spot' Is Huge, But It's Nothing
Compared To Our Other Methane Sources
reports Emily Atkin at Climate Progress. A new study highlights the discovery of the spot, created from natural gas projects, but much more US methane, a short term but very potent greenhouse gas, is emitted yearly from U.S. agriculture, land use, forestry, landfills, and energy production in general.

OO Methane Emissions Soar In Drilling Boom

OO Growing Fracking Dilemma:
How To Dispose Of Radioactive Oil And Gas Waste?

2014-10-20-tarsandexplorationAlbertaCanadaviaRTCCccr239.jpg
Tar Sands Mining: The fossil fuel industry doesn't want you to think that this is dirty.
Howl Arts Collective at Flickr

OO Intense Industry Pressure Causes European Union
To Stop Calling Tar Sands Dirty

OO US Oil Trains Now Delay Transport of
Vital Consumer and Industrial Goods

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png
Even elephants can't survive on oil. Credit: Mary Ellen Harte
<><><><>

OO Three GOP State Legislators Want To Kill
Michigan's Popular Clean Energy Law



OO Fossil Fueled 'Scientist' Congressman: There's No Manmade Climate Change - says this professional medical GOP doctor, supported by the fossil fuel industry. Remind me to consult a climate scientist the next time I feel sick... which is right about now...

OO Senate GOP Candidate: Yeah, We Cause Climate Change - So What?


WHY WE SHOULD ACT NOW: RISING RISKS

Today, the Earth got a little hotter, and a little more crowded.

2014-10-20-anomaltempoct202014.jpg


Daily Climate Change: Global Map of Unusual Temperatures, Oct 20, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.


2014-10-20-fishskeleton500butterflyfishWikipediaccr247.jpg


OO 'The Other CO2 Problem':
How Acidic Oceans Will Cost Our Economy Billions
- and $1 Trillion annually worldwide, a U.N. report predicts, if carbon pollution is not curbed

* *

2014-10-20-tempanomaliesforSept2014NASAccr247.jpg
OO September Was Warmest on Record, NASA Data Shows

OO California Could Be Facing A Mega-Drought - think 30 to 100 years or more; 'our current ground water withdrawal levels are so dangerous that "We are essentially borrowing on tomorrow's future. We'll pay that price over time," says the director of the CA Department of Water Resources.

OO Not Just California: Droughts Extend Across Americas - a dry spell has killed cattle and wiped out crops in Central America; parts of Colombia are rioting over scarce water, and southern Brazil is facing its worst dry spell in 50 years.

2014-10-20-cyclonelossesby2090abycountryclimatecentralccr247.jpg
Via Climate Central

OO Cyclones Under Climate Change to Cost World $10 TRILLION by 2090 - if the prediction of fewer but stronger cyclones hold under worsening climate change. Most climate change predictions tend to underestimate emerging problems, though....

2014-10-20-Englandsabnormalhirainfallviaclimatecentralccr247.jpg
Extreme rainfall that caused flooding in England is just one of many extreme weather events that scientists could be exploring as a possible tie to climate change for the upcoming supplement to the Bulletin of the American Meteorological Society.

OO 2014 Extreme Weather: Looking for Climate Ties

2014-10-20-floodingMiamiflooding41313wildwxatwildwxcomccr227.jpg
Wild wx at wildwx.com

Sea Level Rise Making Floods Routine for US Coastal Cities reports John Upton at Climate Central. East coast city tidal floods could triple by 2030 for some, says a new report, and increase 10 times by 2045.

OO Picture This: Monster Typhoon and Miami's King Tides

2014-10-20-coffeecupofwikipediacctw96.jpg
Wikipedia

OO Price of Coffee Beans Soar To 2½-Year High nearly doubling this year, with thin rainfall clipping output from the world's biggest coffee grower and fueling worries about how already-weakened trees will fare next season.

OO Zimbabwe: Climate Change Hits Banana Farmers

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon


Julia Roberts is Mother Nature; see other hard hitting voices of nature here.

OO Next Big Idea In Forest Conservation? Empower Youth Leaders

2014-10-20-forestfragmentationmehccr247.jpg


Forest Fragmentation's Carbon Bomb: 700+ Million Tonnes C02 Annually reports Jeremy Hance at Mongabay. When forests are slashed into fragments, winds dry out the edges leading to dying trees and rising temperatures. Biodiversity often drops, while local extinctions rise and big animals vanish - and carbon emissions rise.

OO Brazil: Needs New Incentives for Ranchers to Keep Cutting Deforestation says new study.

OO Alaska: Summer Heat, Invasive Insects Cutting Down Birch Trees

OO Borneo: Indonesia To Set Up Palm Oil Monitoring In Bid To Cut Deforestation 80%

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this daisy I photographed in the African wilderness recently. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: The Walrus Sings, Renewables Rising, and More!

(1) Comments | Posted October 13, 2014 | 10:24 AM

2014-10-13-windturbineheliumballoonsAltaerosEnergiesprototypeccr246.jpg
Altaeros Energies is developing turbine-equipped tubular helium balloons that float up to 2,000 feet in the air to capture wind energy. (From Altaeros Energies)


OO A Lighter-Than-Air Turbine To Harness High-Altitude Winds

* *

Read Post

Climate Change This Week: Solar Sunflower, Banks Bank on Clean Energy, and More!

(1) Comments | Posted October 2, 2014 | 10:42 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-10-03-anomaltempoct022014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Oct 2, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is...

Read Post

Climate Change This Week: 400,000 Call For Climate Action, Hottest August on Record and More!

(4) Comments | Posted September 27, 2014 | 3:51 AM

Today, the Earth got a little hotter, and a little more crowded.

2014-09-27-anomaltempsep262014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Jan 16 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is...

Read Post

Climate Change This Week: Energy Efficiency Saves Trillions, US Birds at Risk, and More!

(2) Comments | Posted September 20, 2014 | 3:48 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-09-20-anomaltempSep202014.jpg


Daily Climate Change: Global Map of Unusual Temperatures, Sep 20, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming,...

Read Post

Climate Change This Week: Solar Jobs Rise, So Does Global Heat, and More!

(17) Comments | Posted September 14, 2014 | 4:01 AM

Today, the Earth got a little hotter, and a little more crowded.

2014-09-13-anomaltempsep132014.jpg


Daily Climate Change: Global Map of Unusual Temperatures, Sep 13, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming,...

Read Post