iOS app Android app

Mary Ellen Harte
GET UPDATES FROM Mary Ellen Harte
Mary Ellen (Mel) Harte Ph.D. is a biologist who writes on climate change and population issues. She co-authored the free downloadable book, Cool the Earth, Save the Economy, at Cool the Earth, and produces the weekday "Climate Change Report," 90-second audio newscasts, as well as the Climate Change Reports blog.

Entries by Mary Ellen Harte

Climate Change This Week: Forget Flaring, Solar Light Bulbs, and More!

(0) Comments | Posted April 27, 2015 | 5:39 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-04-27-1430167779-2327253-yellowstoneparkSourcewww.touristdestinations.netccr274.jpg

Imagine This Looking Like Arizona: a new study suggests climate change could dramatically dry out Yellowstone Park. Source: www.tourist-destinations.net

OO By 2100, Yellowstone National Park Likely To Be Incredibly...

Read Post

Goldman Prize Winners 2015: When Art Empowers Society, and So Much More!

(0) Comments | Posted April 21, 2015 | 11:14 AM

Once again, Goldman Prize awardees embody how single, determined individuals across the world can mobilize enough groundswell to conquer industrial Goliaths. Hailing from diverse backgrounds, these 2015 superheroes form a fountain of inspiration for all of us, and their weblinks show how we can act.

At the awards ceremonies,...

Read Post

Climate Change This Week: Methane Blob, Renewables And Global Heat Rise, and More!

(0) Comments | Posted April 20, 2015 | 4:32 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-04-20-1429559546-4997281-ClimateChangeDenialDisorder1ccr273.png


@@ Funny or Die: Climate Change Denial Disorder - absolutely hilarious. Enjoy, and share!

* *

@@ How Much Fossil Fuel Is Extracted...

Read Post

Climate Change This Week: The Hot Race of Clean Energy vs Worsening Weather, and More!

(0) Comments | Posted April 13, 2015 | 3:58 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-04-13-1428953477-8427194-politicianssupportcleanenergymehccr272.png


OO Why Solar And Wind Energy Will Take Over Our Power Grid
Much Sooner Than You Think

1. Bipartisan political support is growing
2....

Read Post

Climate Change This Week: Record Hot Antarctica, the Immoral Ethics of Denial, and More!

(3) Comments | Posted April 6, 2015 | 12:23 PM

Today, the Earth got a little hotter, and a little more crowded.

Breaking: Climate Change Hoax Revealed!

Wow, this is SUCH a relief! I was really worried there, for a few decades...

* *

Okay, back to reality, after a late April fools... sigh...

@@ The Elevator Pitch on Climate Change: Naomi Oreskes
Harvard professor of scientific history, and author of OO Merchants of Doubt describing the industrial campaign to create public doubt and confusion about the science of climate change.

* *

2015-04-06-1428336768-8037444-chickSourceidealpoutry.comccr271.jpg
Source idealpoutry.com

Climate Change Creature Feature: Scientists race to develop heat tolerant chickens, whose production is also a significant source of global carbon emissions.

* *

2015-04-06-1428334755-2876655-journalistwikipediaccr271.jpg
Wikipedia

How Should Journalists Treat Candidates Who Deny Climate Change? Educate the readers on the real reason for climate change denial, reports Michael Hiltzik at the Los Angeles Times - that is, the fossil fuel industries' financing of climate change denial candidates. Don't be fooled by their scientific sounding gibberish - follow the money, folks!

Related Headline:

OO Media Contribute to 'Hope Gap' on Climate Change - by emphasizing the catastrophes and under-reporting the technological and political solutions.

*
*

2015-04-06-1428334790-6060611-forestfragmentationworldwide2015asourceclimateprogressccr271a.jpg

Only two major large forests remain on Earth: in Brazil's Amazon, and in Africa's Congo Basin (blue patches). 70% of the remaining forests are within 1 kilometer of forest edge due to human induced fragmentation. Bar graphs show historical declines in Brazil forests. Source Climate Progress

There Are Only Two 'Big Blobs' Of Forest Remaining On Earth says a new study, reports Ari Phillips at Climate Progress - one in Brazil's Amazon, the other in the African Congo. Worldwide, 70% of remaining forest is within 1 kilometer of forest edge, as forests fragments under the increasing pressure of expanding human developments.

2015-04-06-1428334824-6059904-forestfragmentationBrazilsourcemongabayccr271.png
Fragmentation results in up to a 75% loss of biodiversity, and seriously impairs ecosystem functions. Source: Mongabay

On the brighter side:

OO New Online Platform Tracks Corporate Actions In Tropical Forests - like illegal deforestation, or violating pledges not to destroy forests.

2014-07-06-populationmatters2green.png

*** As populations rise, we lose even more forests. ***

If we do not grow sustainably, Our children will die inhumanely.

WHAT YOU CAN DO

Raise public awareness about the population problem. Talk to your friends and colleagues, to your representatives, and to the media.

And there are many more actions you can do, right here.


*
*
*

SOLAR KEEPS DANCING

2015-01-19-solarkeepsdancingonthebeachatflickrccr260.jpg

OO Solar Energy Emerging As Cheapest Power Source
In Many Parts Of The World
by 2025 says a new report, but the success of that scenario depends on stable regulations.

OO Georgia Legislature Unanimously Approves Third-Party-Owned Rooftop Solar

OO New Kind of Tandem Solar Cell uses two different layers of solar absorbing materials (silicon and perovskite) to harvest a far broader range of sunlight. This could up the efficiency of solar cells.

2015-04-06-1428334933-1277256-solarthermalplant2Ivanpah_Solar_Power_Facility_OnlinecreditAioannidesatwikimediacommons_resize.jpg
The Ivanpah solar thermal facility.Credit Aioannides at wikimedia commons

OO California Leads States In Getting 5+% Of Its Power From Large Solar Projects

OO California: PG&E Hits A Milestone Of 150,000 Solar Customers

2015-04-06-1428334966-4887152-solarmoney.png


OO Florida Conservatives Trying To Make Solar Energy More Accessible with a petition seeking to legalize the sale of solar power from one citizen to another.

OO Community Solar: Key Considerations in Designing a Successful Program are who owns the installation and where to locate it.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2013-12-08-smog659pxBeijing_Forbidden_City_SmogacreditBrianJeffreyBeggerlyviawikimedia_resize.jpg
Smog over the Forbidden City in Beijing, China. Credit Brian Jeffrey Beggerly via wikimedia commons.


OO China: Beijing to Shut All Major Coal Power Plants to Cut Pollution

OO China: Shenzhen City To Pump $800M Into Electric Car Incentives

2015-04-06-1428334994-2995409-coalmineWyomingwikipediaccr271.jpg
Coal Mines: Eyesores That Will Not Be Missed. Wikipedia

OO US Coal Sector In 'Terminal Decline' say financial analysts, with the coal industry losing 75% of its value in the US over the past 5 years, and over 200 mines closing.

Related Headline:

OO Deteriorating Coal Markets May Lead
Coal Companies to 'Run Out of Time'
says
BB&T Capital Markets analyst Mark Levin.


OO Plan To Expand Regional Support For Wind Power
Takes Shape In The Midwest

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

Renewable Energy Grids Could Dominate 'in Our Lifetime' say a majority of energy industry experts, reports Julia Pyper at Greentechmedia. Getting to 70% renewable generation is not a technical question, but political one, says one exec.

OO US Cities and Towns Choose Renewables to Save Money

OO EPA: New Cars Are More Efficient Than Ever By Far

2015-04-06-1428335045-5302200-windfarmgreenviawinddailycomcctw97.jpg via winddaily.com

OO A Big, Clean Energy Industry Matures At Sea where unobstructed winds off the coast of Denmark, for example, are capable of spinning up enough power to electrify around 1 million German households.

OO U.K. And Norway To Build Multi-billion Electricity Link
To Access Renewable Energy
from Norway to UK, when needed, potentially cutting electricity bills.

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO India: Renewables To Get Most Of $1 Billion Bank Credit

OO Oslo's Decision To Divest From Coal
May Inspire Bigger Cities To Do The Same
- a series of major urban areas have made bold moves recently, ridding themselves of fossil fuel investments and becoming more carbon friendly.

* * *

WHAT WORKS

Speaking Out:

2015-04-06-1428335091-46183-neiltysoncosmosSourcethehigherlearning.comccr271.jpg
Neil deGrasseTyson hosted the extremely popular series "Cosmos", which aired on Fox and National Geographic.

OO Neil deGrasse Tyson: Voters Are Responsible
For Electing Climate Leaders or Deniers
and need to be better educated on climate change.

OO Museums' Ties To Climate Denying Koch Brothers Not OK, Scientists Say

OO Oil Giant BP Drops Membership With Conservative Lobbying Group ALEC that pushes legislation favoring big polluters over citizens' health.

2015-04-06-1428335125-9165230-episcopalianbishoponunethicsofclimatedenialCreditTonyAvelarAPPhotoccr271.jpg
Presiding Bishop of The Episcopal Church, the Most Rev. Katharine Jefferts Schori, right, said that denying climate change is akin to turning one's back on God's gift of knowledge. CreditTonyAvelar/AP Photo

OO Episcopal Presiding Bishop Makes Religious Case Against Climate Denial noting that those who deny the overwhelming facts abuse God's gift of knowledge and the ability to think.

OO California Gov Jerry Brown: Ted Cruz Unfit for Presidency
Because of His Climate Change Views

OO Guardian Media Group Divests Its $800 Million Fund of Fossil Fuels

Informed Leadership:

2015-04-06-1428335224-2353840-ParispollutedPhotographWittSipaRexccr271.jpeg
The summit of European city leaders comes after Paris was recently declared the most polluted city on the planet when a choking cloud almost obscured its most symbolic monuments. Photograph: Witt/Sipa/Rex

OO Leaders Of European Cities Make Pledge To Tackle Climate Change

OO Maryland: Senate Passes Bill
To Declare Fracking An 'Ultrahazardous Activity'

Insights:

@@ Jon Stewart Pretends Climate Change Doesn't Exist - the gem is 3 minutes in, with actual footage of a Florida state official trying not to say the words "Climate Change" with hilarious results - but stick around for understanding just who is sucking up all the water in California - and getting away with it. For a better video copy go here.

For just the gem I referred to above, watch:

OO Florida's Unspeakable Issue Leaves Climate Change Official Tongue-Tied

2015-04-06-1428335320-6370915-wildfirevortex500MorganFireNEofSFcredMattGranzcourtesytwittersacramentoNationalWeatherService_resize.jpg
Credit Matt Granz, Courtesy Twitter,/Sacramento National Weather Service

OO Wildfires Tied to Drought, Heat & Topography, Not Beetles

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

OO Japan Uses Climate Cash For Coal Plants

OO Canada Pushes Ahead with Alternatives to Keystone XL

OO Water Use For US Fracking Has Skyrocketed, USGS data show, even as the western drought makes the stuff ever more precious.

Bad Ideas:

2015-04-06-1428335362-8209284-droughtsignprayforrainsourcefacebookccr253.jpg
Source facebook

OO How Growers Gamed California's Drought - Consuming 80% of California's developed water but accounting for only 2% of the state's GDP, agriculture thrives while everyone else is parched.

OO China's Massive Use of Cement a Big Source of Carbon Emissions - and it is using more than it really needs.

Clueless Leadership:

OO Ted Cruz Is Trying To Gut The Clean Air
Act And Repeal All Climate Regulation

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2015-04-06-1428335430-7907083-anomaltempapr052015.png

Daily Climate Change: Global Map of Unusual Temperatures, Apr 5, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-04-06-1428335494-2940342-icebergantarcticcreditNOAAFlickr.jpg As Antarctica warms up, so is the melting of its ice shelves. Credit NOAA at Flickr

OO Antarctica: Record-Breaking Hot Temperature Recently - 63.5°F. Setting a new all-time temperature record for an entire continent is an exceedingly rare event, reports Ari Phillips at Climate Progress. Meanwhile, new heat records worldwide are far outpacing new cold records.

Related Headlines:

OO 63.5°F in Antarctica - where the most recent century has been the fastest warming one in the past 2,000 years.

OO Antarctic Ice Shelves Melting 70% Faster a new study shows, raising concern that an important buttress keeping land-based ice sheets from flowing to the sea could collapse or vanish in coming decades.

OO Antarctica's Icy 'Doorstops' Thin, Creating Rising Seas Risk

2015-04-06-1428335538-3642459-gulfstreamslowsthedailyclimateccr271.jpg
Source: The Daily Climate

OO The Gulf Stream System May Already Be Weakening: Not Good -this crucial heat conveyor belt hasn't been this weak in 1,100 years, perhaps due to an influx of freshwater from Greenland's melting ice sheet.

OO Report: Diversity Of New England Plant Life Is Threatened by climate change and expanding human development.

OO California Snowpack Hits All-Time Low: 8 %Of Average

2015-04-06-1428335624-8345628-starvingsealionpuponCAbeachfeb2015CreditNOAAFisheriesWestCoastatFlickrccr271.jpg
Starving sea lion pups are just the most visible dramatic effect of warming waters on US coastal ecosystems. Credit NOAA Fisheries West Coast at Flickr

OO The West Coast Is in Hot Water creating a slew of changes to marine food chains.

Social Repercussions:

OO The Salton Sea: A Time-Bomb Amid California Drought - As the sea dries, the toxic pollutants in its bottom are set to be dispersed by wind, polluting far and wide, as migrating birds are deprived of an important rest stop.

OO Florida's Climate Denial Could Cause Catastrophic US Recession - because there's now a trillion-dollar real-estate bubble in coastal property. When it bursts from a catastrophic storm, U.S. taxpayers -- all of us -- will have to pay the bailout bill.

2015-04-06-1428335659-5077239-IndiamonsoontrafficCreditLijiJinarajatwikipediacommonsccr271.jpg
Indian traffic as monsoons flood. Credit Liji Jinaraj at wikipedia commons

OO Tropical Rainfall Rising As Big Storm Events Increase, especially big thunderstorms, study finds.

OO Australia: Queensland To Create Permanent Disaster Recovery Agency to deal with a future of more extreme cyclones and floods brought on by climate change.

* * *

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these strawberries I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Melting Poles, Fading Forest, Solar Soars, and More!

(0) Comments | Posted March 30, 2015 | 10:23 AM

Today, the Earth got a little hotter, and a little more crowded.

2015-03-30-1427724073-9971610-amazoninsectPerugooglejungleperuccr270.jpg
As we cut down much of the Amazon forest , much of the rest is starting to die off, greatly decreasing the cheapest way to store carbon in the world....

Read Post

Climate Change This Week: Warming Accelerating, US Utilities Going Green, and More!

(1) Comments | Posted March 23, 2015 | 5:34 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Censoring South Florida Sea Level Rise - maybe state employees aren't allowed to say the words, but mother nature doesn't care - Florida is being increasingly flooded by rising sea levels from climate change.

@@ Brought to you by the Climate Change Youtube Channel

* *

2014-07-06-populationmatters2green.png

OO Malawi: 'God Commanded' Family Planning,
Says Muslim Leader
in a flood ravaged village, where climate change and population are intersecting --So much so, that long-held cultural assumptions are starting to change.

Related Headline:

OO Population Increases Flood And Drought Threat To Cities

* *

2015-03-23-1427144717-1415973-peatswampinMalaysianBorneomongabayccr235_resize.jpg
A lush peat swamp, home to endangered wildlife. Rhett Butler at Mongabay

OO Scientists Warn Peat Fires, Global Warming May Intensify Each Other as peatlands are drained for agriculture or dry up from climate change.

* *

2015-03-23-1427144754-4458359-solarmoney.png


OO Solar Power Got Cheaper at a Record-Breaking Pace in 2014


*
*

2015-03-23-1427144796-5550407-RussianheatwaveJuly20toAug172010CreditNASAccr269.jpg
A new study implicates Arctic warming in helping create prolonged heat waves around the world, including Russia, as it did above during July and August 2010. Red dots indicate the heat wave, which also helped fuel many wildfires there. NASA

Summer Heat Waves May be Linked to Arctic Warming says a new study, reports Andrea Thompson at Climate Central. It implicates Arctic warming in helping create prolonged heat waves around the world by stagnating weather systems that allowed heat and dryness to build.

Related Headline:

OO Arctic Melt Brings More Persistent Heat Waves To US, Europe - the US, Europe and Russia face longer heat waves because summer jet stream winds that formerly brought cool ocean air have been weakened as climate change melts the Arctic, German researchers said.

* *

2015-03-09-1425909093-8365465-TimetoWakeUpccr267.png

@@ Time to Wake Up: Corporate Climate Responsibility 2.0

It's time for a a US corporate step up to recognizing the importance of taking steps to address climate change - and many are doing so. When will Congress?

* *

2015-03-23-1427144833-7982271-kidsunderstandclimatechangechildrenTheDailyClimateccr269.jpg
The Kids Get It: climate change is real, and needs action. Now will Congress get it?

OO Poll: 90% Of 12-Year-Olds Understand That Climate Change Is Real - students will visit a dozen offices to ask senators -- including Mitch McConnell, Marco Rubio, Ted Cruz, Rand Paul -- to take a simple elementary school quiz on climate change science.

* *

2015-03-23-1427144868-2220554-hotweatherinthecityCreditSeveralSecondsatFlickrccr269.jpg
Credit Several Seconds at Flickr

Warming Could Hit Rates Unseen in 1,000 Years says a new study, reports Brian Kahn at Climate Central, especially affecting the northern hemisphere first, becoming so fast that "there's not going to be anything close to equilibrium," said lead researcher Steven Smith, underscoring the profound potential impacts on both the natural world and society.

Related Headline:

Rate Of Climate Change To Soar By 2020s
With Arctic Warming 1°F Per Decade
says a new study reports Joe Romm at Climate Progress. It projects that the rate of climate change, which has risen sharply in recent decades, will soar by the 2020s. This is consistent with several recent studies and has dangerous implications for extreme weather, sea level rise, and permafrost melt.

* *

2015-03-23-1427144920-8143070-keepitinthegroundcampaignSourceUKGuardianccr269.jpeg

YOU CAN ACT: Keep It In the Ground Campaign

Join this new campaign launched by the UK Guardian, one of Britain's most reputable news organizations, in petitioning the world's top 2 charitable organizations to divest from fossil fuels. You can do so here.

* *

2015-03-23-1427144966-8362266-amazonoilpollutionCaroBennettatAmazonWatchatinstagramccr269.png

Caroline Bennett at instagram
@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

Smelling the Peril of Oil: Cofán leader Emergildo Criollo smells remnants of crude oil in a river in the northern Ecuadorian Amazon, where a legacy of destructive oil operations continues to contaminate the region's water supply and rainforest.

* *

2015-03-23-1427145008-5904653-mississippifloodingMargaretCroftAParchiveccr269.jpg
The Mississippi floods. Margaret Croft/AP archive

OO River Flooding To Affect 40 Million People Annually By 2030

* * *


SOLAR KEEPS SMILING

2015-02-02-solarkeepssmilingpanelfield300x197ViaSolar.calfinder.com.jpg

OO US Solar Capacity Up 30% in 2014 Over 2013

OO Batteries Paired With Solar Panels Could Shake Up Electric Utility Sector - Emerging plans to pair residential solar panels with mass-produced residential batteries are on the verge of confounding the electric power industry.


OO US Utilities Increasingly Focused on Solar Energy and Its Storage says a new report.

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO You Can Now Invest In Solar Bonds
Through Your Retirement Account

"You can earn good economic returns and do good with your money at the same time."

OO Cities Could Be Ideal for Utility-Scale Solar Plants in California, says a Stanford University study.

OO California Is Building the Largest US Floating Solar Project - the 12.5-megawatt project will be able to serve 3,000 homes.


2014-01-31-geostellargetcleanenergy.png

Check it out here, right now!
* * *

GOOD CLEAN NEWS

2015-03-23-1427145041-2891634-windturbinefarmrainbowEugeneGarciaatAPccr269.jpg
Eugene Garcia/AP

OO US Wind And Solar Are Growing Much Faster Than Fossil Fuels says a new federal report.

OO Wind Could Make Up 35% of US Electricity Generation by 2050 says the US Dept of Energy.

Related Headline:

OO Wind Could Power 35 Percent of U.S. Electricity by 2050 ...
IF Wind Power Got The Same Tax Breaks As The Fossil Fuel Industry
- but it doesn't look like Congress will renew it. Hey, what gives, Congress?

*
*

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

US Utilities Moving Towards Renewable Energy:

OO Florida Utility To Buy & Shut Down Coal Plant Early - stopping 1 million tons of CO2 emissions yearly.

OO California: Utilities Commission To Replace Nuclear, Gas Plants
With Green Energy Options like renewables, energy efficiency and energy storage.

OO Largest US Utility to Rely More on Natural Gas, Renewable Energy - it's the TVA.

* *

2015-03-23-1427145075-4808532-LithuaniaTrakaiCastlesourcewww.worldtravelguide.netccr269.jpg
Lithuania joins Sweden, Bulgaria, and Estonia in surpassing its clean energy goals.
Source: www.worldtravelguide.net

OO Four Countries Surpass EU Renewable Goals Early

OO Record First: Global CO2 Emissions Went Flat In 2014 While The Economy Grew

2015-03-23-1427145125-5486019-chinesedragongreenccr234.jpg
China's use of coal dropped 3% last year, and now plans further cuts.

OO China Targets Coal Usage Cuts In Its New Energy Plan

OO China's Push To Cut Coal Use
May Be Bad News For US Exporters

OO The Electric Car Battery Race Is On: China vs. Tesla

* * *

WHAT WORKS

Speaking Out:

2015-03-23-1427145188-9610740-forestPitsfieldMARhettButlerccr257.png
Rhett Butler at Mongabay

OO Scientists Warn Of Global Warming Threat To Temperate Rainforests and call to reduce emissions before it's too late.

OO Scientists Warn G20: $60 Trillion Infrastructure Plan
Reinforces "A Dangerous Vision"
- infinite growth is unsustainable.


OO UN Report Warns Of Grave Consequences If Mangroves Not Protected impacting food security, biodiversity, and human coastal communites worldwide

2015-03-23-1427145235-2010496-ChristianscatholicspopeonclimateTheDailyClimateccr269.jpg

OO Christian Duty: Cardinal Indicates Themes
Of Pope's Climate Change Document

OO US Secretary of State Kerry:
Ignoring Climate Change Is 'Just Plain Immoral'

OO Lawsuit Seeks Strict Limits On Massachusetts Greenhouse Gas Emissions - brought on by a group of teenagers trying to make a difference - more power to them!

2015-03-23-1427145273-7411360-wheatwikimediabeerallthesamesongcom.png
Climate change is not good for brewing beer, and US brewers know it. Sources: Wikipedia, allthesamesong.com

OO US Beer Brewers Call for Action on Climate Change

2015-03-23-1427145313-9341512-UnitedNationsFlagsgoogleccr269.jpg

OO UN Backs Fossil Fuel Divestment Campaign

OO Australia: Coal Is Burning Up Australia's Future say public groups, who are pushing elected leaders to account for their national commitments to lower carbon emissions to cap runaway global warming.

OO Bank of England: Climate Change Is One of the Biggest Risks
To Insurance Industry

OO London to Divest Fossil Fuels
From City's Pension Fund
- a $9 billion fund.

Good Ideas:

2015-03-23-1427145368-7228712-YosemiteInteriorDepartment_resize.jpg
US Interior Department

OO Public Lands May Be America's Best Climate Defense - they protect forests that help store atmospheric carbon dioxide emissions while providing space for renewable energy development and protecting wildlife habitat and biodiversity, helping plants and animals adapt to climate change, says a federal official

OO Banks Increasingly Not Financing Mountantop Coal Mining

OO Germany Seeks To Boost Renewable Sources Of Heating for buildings.


Important Insights:

2015-03-23-1427145401-9590941-twocyclonesoppositeeachotherrightsideNOAAccr269.jpg
The two cyclones on the right could jolt the El Nino weather effect. The lower one, Pam, has already wrecked Vanuatu. NOAA

OO 'Twin' Cyclones Could Jolt Weak El Nino - spinning opposite each other on either side of the equator.

OO Climate Change Can Skew Fish
Gender Ratios Towards More Males
-- with fewer females actually producing fish.

OO Climate Change To Blame For Mysterious Siberia Craters - say Russian scientists.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

2015-03-23-1427145432-9847536-coalashdumpsinNCarolinaownedbyDukeEnergySourceTheDailyClimateccr266.jpg
One US legacy of coal: coal ash dumps pollute our landscape.

OO US, Chinese Companies Dominate List Of Most-Polluting Coal Plants


OO We Keep Spilling Oil Into America's Greatest Rivers

OO Crude-Oil Train Wrecks Raise Questions About Safety Claims - as 4 accidents in the last month show.

2015-03-23-1427145475-198130-oiltrainderailsburnsinWVAfeb2015CreditCBSNewsscreenshotccr266.png
Credit CBS News, screenshot

Related Headlines

OO Fast-Growing Railroads Will Miss Safety System Deadline

OO Train Deaths Rise Amid Energy-Driven Rail Transformation

OO Crude Oil Price Collapse Busting North Dakota Oil Boom

2015-03-23-1427145526-124451-arcticicemeltpolarbearonsmallbergGerardVanderLeunFlickrccr231.jpg
Arctic drilling will add one more stress to the wildlife already stressed by rapid warming. Credit Gerard Van der Leun, Flickr

OO Shell To Start Arctic Oil Drilling This Summer

OO Shell Using Seattle Ports For Arctic Drilling Rigs
"If I had to pick a logo that says, 'I'm for climate chaos,' I could hardly do better than an Arctic drilling rig."


Clueless Leadership:

OO Ohio: Paying An Ecnomic Price for Stalling on Clean Energy

OO Four US States Push Koch-Backed Legislation
To Ban Funding EPA's Climate Rule
- as oil barons try to rule over the public.


2015-03-23-1427145573-6367370-CroatiaDubrovnikcroatiatravelco.comccr269.jpg
Croatia's lucrative beauty is at risk from developing fossil fuels industry in the Adriatic. croatiatravelco.com

OO Croatia 'Sleep-Walking' Into Destroying Tourism
With Adriatic Energy Industry


OO EU Nations Climate-Minded At Home,
But Promoting Coal Products Abroad

OO India: Solar Minded Minister Slashes Environmental Funding


*
*
*


WHY WE SHOULD ACT NOW: RISING RISKS

2015-03-23-1427145617-2437000-anomaltempmar222015.png


Daily Climate Change: Global Map of Unusual Temperatures, Mar 22, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-03-23-1427145672-6675706-warmest12monthsuptofeb2015NASAccr269.jpg

OO NASA: Earth Tops Hottest 12 Months On Record Again,
Thanks To Warm February

OO Arctic Sea Ice Dwindling Toward Record Winter Low

OO Land, Ocean Carbon Sinks Are Weakening,
Making Climate Action More Urgent

2015-03-23-1427145705-4698228-sealionsinCASourcetheDailyClimateccr266.jpg
Pacific Marine Mammal Center, AP photo

OO Hundreds Of Sick, Dying Sea Lion Pups
Are Washing Up On California's Shores
- as warmer waters have driven their food supplies away.

Social Repercussions:

OO Why Fresh Water Shortages Will Cause The Next Great Global Crisis

OO Climate Change on International Disaster Talks Agenda

OO "Monster" Cyclone Pam Destroys Much Of Vanuatu,
Officials Blame Climate Change


2015-03-23-1427145759-1589088-foginCaliforniawww.geog.ucsb.educcr269.jpg
A disappearing act? Concrete in southern California has contributed to the disappearance of cool, moist fog. Source www.geog.ucsb.edu

OO Southern California's Concrete Contributes to Drought,
By Discouraging Coastal Fog

OO Washington State Rain No Cure For Drought,
Due To Bleak Snowpack
- It is possible to have rain -- lots of it -- and still be plagued by drought.


OO Baked Alaska - If the Last Frontier is the canary in the climate coal mine, we're in trouble.

2015-03-23-1427145792-8067233-Icehockeywikipediaccr269.jpg
Wikipedia

OO Canada: Climate Change Spells End To Ice Hockey say experts.


*
*
*

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon


2015-03-23-1427145833-9697356-orangutanIndonesiandeforestationforbiofuelsphotomontageSOBIARIndonesiaRANccr266.jpg
We all suffer when forests are destroyed. Source SOB - IAR Indonesia, RAN

Problems:

OO Soil Releases Carbon For Decades After Forests Are Felled study finds.

OO Endangered Forests Shrink As Demand For Soy Rises

OO Myanmar: Commercial Agricultural Expansion Fueling Illegal Logging, Land Conflicts

2013-11-28-rainforestbirdscarlet_macaw_04RButler_resize.jpg
One of the many gifts of carbon-storing forests. Credit Rhett Butler at www.mongabay.com

OO Brazil Confirms Rising Deforestation In The Amazon

OO Proposed Law Could Decimate Indonesia's Remaining Forests

OO Liberia: Local Land Rights At Risk From Push For Palm Oil


Solutions:

2015-03-23-1427145879-8451878-Surinameeldersmongabayccr269.jpg
Suriname elders. Mongabay

OO Suriname: Indigenous Leaders Present Plan
To Govt For Largest Official Protected Area

OO Palm Oil Giant Buys PNG Firm
Noted For Environmental Practices

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this tundra rhododendron I photographed one summer. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: The Chinese Connection, Solar Jobs Fly, and More!

(0) Comments | Posted March 16, 2015 | 6:53 PM

Today, the Earth got a little hotter, and a little more crowded.


@@ Climate Change, the Elevator Pitch: Richard Alley,
Climate Scientist -- and Republican

@@ Richard Alley on being a Republican

* *

2015-03-16-1426544520-6783867-windturbinescoalcoolingtowersemitsteameasternGermany2009CreditPawelKopczynskiReutersccr268.png
The Future Is Up Front: Wind turbines churn as coal cooling towers behind them emit steam in Germany 2009. Credit Pawel Kopczynski, Reuters

2014: First Time in 40 Years, World Economy Grew But CO2 Levels Didn't! says a new International Energy Agency Report, writes Chris Mooney at the Washington Post. Several factors are at play here, such as: China and other countries move towards renewables, higher energy efficiency overall, more efficient cars, and gas replacing coal in the US and elsewhere.

Another myth shatters: we CAN economically prosper as we move towards clean energy!

* *

2015-03-09-1425909093-8365465-TimetoWakeUpccr267.png

Time to Wake Up: Republicans Outside of Congress Support Action on Climate Change - this is an oldie but goldie from December 2013, but still relevant today - unfortunately.

* *

2015-03-16-1426544587-3120792-crucifixwindowagainstblackCreditMarkAbelnccr268.png
Credit Mark Abeln

Through a Christian Lens:
God Created Universal Laws That Explain Manmade Global Warming

writes Chris Mooney at the Washington Post, in response to Senator Inhofe's strange mix of willful ignorance and literal biblical interpretations. Understanding how those laws operate can be viewed as a form of religious devotion, as even Galileo once indicated.

* *

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

2015-03-16-1426544646-2067861-energyefficienttatamisleepspeopleinunheatedwinterroomJamesDelanoWhitlowatinstagramccr268.png
Credit @jameswhitlowdelano
An energy efficient tatami bedroom in Tokyo, Japan: One way the average Japanese person consumes roughly 50% as much energy as the average American is by sleeping in unheated houses even on nearly freezing winter nights The tatami (mat) room gets down to 46-50F, but it gets hot beneath the blankets stacked high.

2014-07-06-populationmatters2green.png

How Can 1 Billion Chinese Affect the USA?

Answer: China's Pollution Could Be Behind Cold, Snowy US Winters say NASA scientists, reports Michaeleen Doucleff at National Public Radio. As China has become a major carbon polluter in recent decades, more of its pollution (animation here) blows over the Pacific and ends up in Canada, where the carbon particles can form the nuclei of snow - lots of it, which then gets funneled into the northeast US. due to the changing jet stream.

Chinese Pollution Makes Life Horrendous for Chinese, Too:


What if YOU had to worry about your new baby surviving pollution? This gut- wrenching scene is the opening salvo indicting China's catastrophic and pervasive pollution.

@@ Full video: Under the Dome - Investigating China's Smog

OO China Blocks Web Access To "Under The Dome" - as it went viral, the searing documentary about China's catastrophic air pollution, had hundreds of millions of Chinese views, garnering praise for its honesty from official Chinese press. After one week, the government banned it.

* *

And New York Thought It Had It Bad...

2015-03-16-1426544682-1474923-8ftsnowin16hoursrecordCapracottaItalySourceUKtelegraphccr268.jpg
OO 8 Feet of Snow in 16 Hours dumped on Capracotta, Italy, a little mountain village, recently, breaking previous records. Source UK Telegraph


Meanwhile...
*
*

2015-03-16-1426544726-2972265-4cyclonesinthesouthwestPacifcnrAustralia2Mar122015SourceWeatherChannelccr268.png
OO 4 Cyclones Hovered over Australia Recently! Source Weather Channel

OO Satellite Data Suggests Forest Loss Is Accelerating much faster than previously thought. Oh-oh.

OO A New Price To Pay For Destruction Of Forests:
Resurgence Of The Plague
Deforestation to expand agricultural lands could be exposing more people to diseases like the "Black Death," which devastated populations in the Middle Ages


*
*
*

Related Headline:

SOLAR KEEPS SAILING

2014-11-10-solarkeepssailingsydneyharbourwikipediaccr250.jpg

OO US Solar Generation Doubled in 2014
Renewable Output Grew 11%
- and that's not counting rooftop solar or distributed renewables

OO Solar Energy Jobs Growing By Leaps and Bounds

2015-03-16-1426544783-2494231-solargridstorageSourcegigaom.comccr268.jpg
Source: gigaom.com

OO First Big US Solar Company Dives into Energy Storage - the development that cements solar's future, and SunEdison has taken the jump.


2015-03-16-1426544820-5311165-NewYorkcityskylineCreditEmmaJohnsonccr268.jpg
New York City. Credit Emma Johnson

New York Just Showed Every Other State How To Do Solar Right by forcing utilities to partner with service providers of distributed clean energy, rather than own the energy providers: this sets up a healthy competition among providers and resets utilities' vital function in maintaining the grid in this new energy world order, reports Tim McDonnell at Mother Jones. It could be a national model.

OO Rise In Rooftop Solar Systems Is Game-Changer For Electric Utilities

OO Going Solar in CA:
A Comprehensive Guide to Rebates and Tax Credits

2015-03-16-1426544853-3829827-solarplaneinprofileSourceTheDailyClimateccr268.jpg
Source: The Daily Climate

OO Solar Plane Completes First Leg
Of Record-Breaking Global Transit

OO Solar Global Transit Plane Resembles Wright Brothers Design

OO Google Will Soon Send Solar-Powered Drones Into the Sky

2015-03-16-1426544892-4348974-solarflarewikipediaccr268.jpg
Wikipedia
Harnessing solar energy from space?

Japan Space Agency Advances In Space-Based Solar Power reports Jun Hongo at the Wall Street Journal. It says that it succeeded in transmitting electric power wirelessly to a pinpoint target using microwaves, which is an essential technology needed for the realization of space-based solar power.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Once Extravagant, Renewable Power Plans Go Cheap


OO Texas: Incentives, Financing Make Going Green
Easier For Commercial Landlords

OO Colorado: US Ski Resorts Are Fighting Climate Change
By Galvanizing Politicians

2015-03-16-1426544941-3424452-cowsandwindturbineonfarmwikipediaccr268.jpg
Wikipedia

OO The USDA Is Helping Rural Farmers Get Their Own Renewable Energy

OO Residential Clean Energy Financing Grows in California - Florida could be next.

<><><><>

OO California: Growing Community Energy Efforts Are Shifting the Utility Model

OO How Connecticut's Advantages Enable Green Energy Innovators To Succeed

2015-03-16-1426544981-2060118-AustraliaByronBaycommitstozeroemitsSourceTheDailyClimateccr268.jpg
Source: The Daily Climate

OO Australia: Byron Bay First Regional City To Commit To Zero Emissions


OO Norway: Oslo Divests From Coal Companies

OO Waste-To-Energy Revolution Going Global

Spread Good Clean News to Your Elected Leaders

2015-03-16-1426545032-1908175-powerofwind.orgturbineandflagccr268.png
Ready to Spread the Vision?

YOU CAN ACT

Make Sure Your Elected Officials Know the Difference Wind Power Can Make.

You can do so by making sure they see the Wind Vision report, which shows how wind power can be America's largest source of electricity by 2050; the report was recently released by the US Department of Energy. Powerofwind.org makes it easy for you to send your elected officials a note here.

Be part of the clean energy revolution!

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO European Union Submits UN Climate Pledge,
Urges US, China To Follow

OO Europe Warned Pollution Will Lead To Premature Deaths says the European Environmental Agency.

OO In India, An Indoor Health Crisis - from fire cookstoves also adds to carbon emissions says the World Health Organization; experts are pushing governments to tackle the problem.

2015-03-16-1426545081-9250851-DemocraticLogopartydonkey2greenwikipediaccr268.png


Informed Leadership:

OO Michigan Democrats Seek 20% Renewable Power by 2022

Good Ideas:

OO Your Shower Wastes A Lot Of Energy And Water:
Here's What You Can Do

OO Climate-Friendly Refrigerants - ozone safe, climate friendlier refrigerants got the green light from the EPA.


OO Energy Efficiency Saves Consumers More
Than Searching for a Better Electricity Price

2015-03-16-1426545125-6116121-zipcarcarsharingcroppedccr268.jpg

OO Germany Tries Electric Car-Sharing Schemes To Boost Sales, Curb Emissions

Important Insights:

OO Oceans May Not Be Able To Cool Climate - as much as previously thought, especially over the next 15 years, says new research.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

2015-03-16-1426545165-9058286-fracking375aoilfieldpumpjackscreditUniversityofTexasviaCPcctw96.jpg Credit University of Texas

OO California Orders Oil Companies To Stop
Drilling Near Drinking Water Supplies
after finding that the companies are contaminating water supplies with oil waste.

OO The True Cost of Gas?
About $4 More Per Gallon Than You Pay Now
says a new study that accounts for the social costs of burning it.

2015-03-16-1426545247-9635168-oilspillonWashingtonRiverMar22015APWashingtonDeptofEcologyccr268.jpg
Oil spill on the Washington River. Credit AP/ Washington Dept of Ecology

OO Motor Oil Spill Contaminates Washington River


OO Australia: Emissions Still Climbing As Coal Use Rises - despite climate change denying govt efforts to curb emissions, says recent report.

Misleading the Public

2015-03-16-1426545284-2865643-RickScottAPatthehuffingtonpostccr268.jpg
Florida Governor Rick Scott has pled ignorance on an important security issue: climate change. AP

OO Florida Officials Ban The Term 'Climate Change' among employees.

OO Florida's Not The Only State Censoring The Term 'Climate Change'


OO Utilities Wage Campaign Against Rooftop Solar


2015-03-16-1426545335-1596465-MitchMcConnellandwifeCreditAPJ.ScottApplewhiteccr268.jpg
Senate GOP leader Mitch McConnell. Credit AP/J. Scott Applewhite

OO Climate Traitor: GOP's McConnell
Tells States To Ignore US Carbon Emission Rules

OO Doubting Climate Science: Produced by ex Tobacco Marketers - who misled the public on how bad smoking is, along with some new faces, all fueled by the fossil fuel industry.

Inadequate Funding

OO India's Clean Energy Research Budget Disappoints Scientists

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2015-03-16-1426545401-5040569-anomaltempmar162015.png

Daily Climate Change: Global Map of Unusual Temperatures, Mar 16, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions:

OO Better Air Quality Helps Lungs Grow, Science Shows

OO Warming Spurt Looms is the ominous conclusion of a vast and growing body of research.

2015-03-16-1426545440-804043-vegetablesfruitswikipedia.jpg
Not for Everyone? Climate change is already disrupting food distribution. Wikipedia.

OO Climate Change Poses Serious Threats To Food Distribution and is already impacting it.


OO Human-Caused Warming Helped Trigger Syrian Conflict, Rise Of ISIS

OO Climate Change Aids Sex Trafficking in the overpopulated islands of Bangeladesh, where climate change worsens poverty, pushing women to fall for false marriage proposals and being lured, instead, into the sex trade.

2015-03-16-1426545480-3370682-droughtsignprayforrainsourcefacebookccr253.jpg

OO California's Terrifying Forecast Of Future: Droughts Almost Yearly says a new study.

OO US Northwest: What A Record-Low Snowpack Means For Summer - it will probably affect salmon production, recreational activities, and later on, in drier areas, agriculture.

Natural Repercussions:

2015-03-16-1426545523-880415-ElNino2015SourceNOAAccr268.jpg
Not Your Typical El Nino, this weather cycle is weaker and will not send California the rain that previous cycles have, but its warming effect will probably help set 2015 as a record hot year.

OO NOAA Announces Arrival Of El Niño,
2015 Poised To Beat 2014 For Hottest Year

Related Headlines:

OO Maps Show El Niño Won't Help the West's Water Woes

OO After Much Ado, El Niño Officially Declared

2015-03-16-1426545560-747362-ThinArcticiceoffthecoastofGreenlandCreativeCommonsNASAGoddardccr268.jpg

OO Arctic Sea Ice Is Getting Thinner, Faster

OO Once Again, A Record-Hot Winter for California

OO Drought Weakens the Amazon's Ability to Capture Carbon

2015-03-16-1426545640-7928877-evergladescowhornorchidCreditVinceLambccr268.png
The rare everglades cowhorn orchid, one of many plants threatened by rising waters. Credit Vince Lamb

OO Florida: Rising Seas Threaten Rare Everglades Plants say researchers

* * *

YOU CAN ACT


OO You Can Stop the Keystone Pipeline

*** Climate Action Across America, March 27 - April 12 ***

Join in: meet with your Congressional representatives, Senators, or their staff about the urgent need for climate action. This is during their Easter recess when they are scheduled to be home meeting with people in their districts. Bring along friends, and be some of those people!

Share your message with the public - letting them know that people across our country are speaking up for climate action, and urging them to contact their elected officials to support climate action.

Share the Facebook page for Climate Action Across America

On Twitter, use the hash tag, #ClimateActionAcrossAmerica.


KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

Threats:

2015-03-16-1426545685-1955953-deforestationforpalmoilinBorneomongabay.jpg
Palm oil plantations eat away at forests in Borneo. Source: Mongabay.com

OO Palm Oil Deforestation Spreads to the Amazon --

Peru: Palm Oil Firms Plan To Destroy 57,000 Acres Of Primary Forest - after deforesting much of southeast Asia, palm oil cultivation is now starting in the Amazon.

OO Humans Cause Erosion 100 Times Faster Than Normal - via deforestation and agriculture, shows a study on the southeastern US.

2015-03-16-1426545780-4823406-MiltonsTitimonkeyCreditJ.Dalponteccr268.jpg
Milton's Titi monkeys are a newly discovered and threatened species with flaming sideburns and tail. Credit J. Dalponte

OO Newly Described Monkey Species Found In Threatened Amazon Forest

OO Madagascar's Frog Haven: Rich, Underexplored, Threatened - on an overpopulated island that has lost most of its forests, and continues to lose more.

OO Somali Charcoal: Funding Terrorism Through Deforestation


Solutions:

2015-03-16-1426545825-4028668-orangutanssourcenatlscifoundation.jpg
When Borneo forests are protected from development, so are their orangutans. Source National Science Foundation

OO Borneo: East Kalimantan Reaffirms Moratorium On New Mining, Logging

OO 3M Unfolds New Policy to Reduce Its Deforestation Impact

OO Researchers, Locals Work Together To Save Ethiopia's 'Church Forests'

2015-03-16-1426545868-23468-BaobobtreeZimbabweCreditKjdhambuzaatWikimediaCommonsccr268.jpg
Africa's iconic baobob trees are endangered by the demand for firewood. Credit Kjdhambuza at Wikimedia Commons

OO Firewood Fervor May Turn Zimbabwe Into An 'Outright Desert' says a new study.

OO Colombia Proposes Protected Corridor Across South America


OO Employing Shame For Environmental Change - a new book explores another--arguably more positive--side of shame: its potential to challenge rule-breaking and ethically-defunct corporations.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this protea I photographed last summer. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Siberia Holes Up, Solar Over Oil, and More!

(10) Comments | Posted March 9, 2015 | 11:20 AM

Today, the Earth got a little hotter, and a little more crowded.

@@ You Can Believe the Senator With a Snowball OR ...
After Senator James Inhofe tossed a snowball in the Senate to illustrate his ignorance of the link between extreme weather (both hot AND cold) and climate change, Senator Sheldon Whitehouse rode to the rescue of sanity on the subject.

2015-03-09-1425909093-8365465-TimetoWakeUpccr267.png


YOU CAN ACT... after you've dissolved into hysterical giggles at the absurdity of Senator Inhofe - and lob a snowball back at him!

Sign here and Environmental Action will deliver dozens of snowballs to Sen Inhofe's office (yes, they're serious), and they'll inscribe each one with a personal message from climate activists like you to the Pro-tem of climate denial.

Signing that made my day...

* *

2015-03-09-1425909199-1069950-chinapopulationsealevelrisecredithessekatharinaatinstagramccr267.png
Credit Katharina Hesse www.katharinahesse.com
@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

The coast in Qingdao in Shandong province, China, during an upcoming rainstorm. Sea levels along the coast are rising faster than the world average due to climate change, recent China media reported.

But take another look at that picture.

The seemingly ordinary family in the foreground must be quite rich, for China levies significant fees beyond having more than one child. As China loosens its one child policy and the increasing, prosperous middle class explodes as energy consumers, so, too, will climate changing emissions and humanity's future explode, unless there is a dramatic switch to clean energy - and we ALL adopt a one child policy.

* *


Merchants of Doubt Documentary is OUT and it's hot! Look for it in your local theaters.

Related Youtuber:

@@ Merchants of Doubt: What Climate Deniers Learned from Big Tobacco

* *

2014-07-06-populationmatters2green.png

Overpopulation and Climate Change Helped Spark Syria Uprising
in conjunction with poor leadership, says a new study, reports the Business Standard. Five recent years of drought, intensified by climate change, slashed food production by a third as the population exploded from 4 to 22 million over the past half century. Poor, corrupt leadership added fuel to the fire.

"Rapid demographic change encourages instability" say the authors. Over a million hungry refugees added to the Iraqi war refugees already flooding city peripheries, and were ignored by government., as food prices and malunutrition soared.

2015-03-09-1425909340-23099-syrianviolenceconflictfatherkidscreditAPVadimGhirdaccr267.jpg
Faces of the conflict in Syria. Credit AP/Vadim Ghirda

A Prelude of Our Future? Only if we let it be: A small family is a healthy one - for the planet, too.

Related Headlines:

OO How Climate Change Helped Spark the Uprising in Syria

OO Climate Change a 'Contributing Factor' in Syrian Conflict

2015-03-09-1425909417-2757188-SaoPauloreservoirSourceBBCccr267.jpg
A Sao Paulo reservoir gets ever lower. Source BBC

OO Climate Change, Overpopulation, and Growing Meat
Create Water Emergencies Worldwide
- think Pakistan, Brazil and California - but the list will expand into water wars worldwide, experts predict, as these three factors further stress water supplies, creating a thirsty, violent world.

OO The Warming World: Is Capitalism Destroying Our Planet?
As long as it embraces infinite, unsustainable growth - think cancer...

*

2015-03-09-1425909509-5326539-craterandmap800xSiberiaCreditVasilyBogoyavlenskyatSiberiantimesccr267.png
New giant craters, presumably created by explosive releases of methane from melting tundra, have appeared in Siberia; in one case, a dozen smaller craters have appeared around a larger one. Credit: Vasily Bogoyavlensky at Siberiantimes

OO Dozens Of New Craters Appear In Northern Russia

Related Headlines:

OO New Giant Siberian Craters Spark Fears Of Arctic Natural Disaster - space satellite photos have revealed the dramatic mushrooming of the holes, believed to be caused by methane gas eruptions in melting permafrost due to climate change, scientists said.

OO Siberian Crater Saga Is More Widespread -- And Scarier
-- Than Anyone Thought

* * *


SOLAR KEEPS RISING

2015-01-26-solarkeepsrising500solarsunrise.jpg

Sunny Side East: Solar Takes Off In Eastern U.S. a new report shows writes Bobby Magill at Climate Central. Utility-scale solar farms are exploding in North Carolina, while eastern U.S. utilities find their own ways to use solar power.

OO By the Time You Read This,
They've Slapped a Solar Panel on Your Roof
- via continuing lower costs and faster installations. Viva la soleil!

OO Even At $10/Barrel, Oil Can't Match Solar On Cost says a new report from the National Bank of Abu Dhabi; it adds that future investment will be almost entirely in renewable energy sources.

OO SunEdison to Bring Electricity to 20 Million Poor Worldwide by 2020 via solar power, making renewable energy a long term, economically sustainable model for them.

Related Headline:

OO SunEdison's Next Market:
Solar Minigrids and Micropower Stations for the Energy Poor

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO Google Invests $300 Million In US Residential Solar Projects

OO Solar Lights A Healthy - And Empowering - Path In Disasters

2015-03-09-1425909575-1230775-TajMahalsolarSourcewww.renewindians.comccr267.jpg
OO Saving The Taj Mahal By Going Solar proposed India in 2013, by having its home city, Agra, go solar to prevent further corroding pollution.

OO India to Quadruple Renewable Capacity to 175 Gigawatts by 2022

OO Australia's Largest Solar Farm Ready To Break Ground

OO Jordan's 6,000 Mosques Will Soon All Have Rooftop Solar


2014-01-31-geostellargetcleanenergy.png

Check it out here, right now!
* * *

GOOD CLEAN NEWS

OO Defying GOP, Obama Vetoes Keystone XL Pipeline Bill-- but this is not a death blow to pipeline.

OO China's Coal Consumption Down 3% In 2014 -
Raises Fear Of Stranded Assets

OO China Cut Its Coal Use Last Year:
Will They Peak Coal Use Before 2020?
- don't be surprised if they do: that would help them peak CO2 emissions before 2030, which is what they told the world last year they would try to do.

2015-03-09-1425909658-4865870-EiffeltowerwindturbineCourtesyofUGEccr267.jpg
Look what the Eiffel Tower just got! Courtesy of UGE

OO The Eiffel Tower Just Got A Wind Turbine Makeover

OO UK Plans Unveiled for World's First Tidal Lagoon Power Plant

And Away They Go...

2015-03-09-1425909757-759753-billgateswikipediaccr240.jpg
Wikipedia

OO Gates Foundation Ditches McDonald's, Coca-Cola, Exxon/Mobil Stock - the foundation doesn't invest in companies whose corporate activity it finds to be "egregious," says its website.

OO Shell Withdraws From Largest Tar Sands Project Yet

OO World's Second Largest Mining Company May Exit Coal Business - Rio Tinto is making moves that could signal its intention to divest coal assets, as coal's price falls.

* * *

WHAT WORKS

Speaking Out:

2015-03-09-1425909826-890873-frackingprotestcampaigninColoradoSourceTheDailyClimateccr267.jpg
Source: The Daily Climate

OO Colorado Anti-Fracking Groups Launch Campaign For Statewide Ban

OO Ten People Arrested Protesting Would-be Virginia Pipeline


@@ Time to Wake Up: Climate Change In Wisconsin

OO Recent Documentary On Air Pollution Grips China - as, many millions of Chinese watched, gripped and outraged, a 104-minute video , which even got favorable mentions in state Chinese media.

OO European Commission: We Must Act Urgently on Climate Change says a new memo to nation heads within the European Union.

OO Canadian First Nations Seek To Protect Forest Homeland from fracking and fossil fuels development, thus helping to slow climate change.

2015-03-09-1425909906-7781919-donothingonclimatechangeStanMeiburgasthmatoddler500ccr264inccr267.png

YOU CAN ACT

An out-of-state oil company with a questionable track record wants to export its toxic fracking wastewater into Nebraska, dumping 80 truckloads carrying 10,000 toxic barrels daily into a disposal well in Sioux County.

This would transfer the risks of its toxic pollution onto Nebraska farmers and ranchers and our land and precious water resources, such as the Ogallala Aquifer a major source of irrigation for midwest farms..

Help us protect our lives and resources: Please sign the petition: Don't frack our water.

Good Ideas:

OO US Congress Democrats Demand Fossil Fuel Disclosure
Of Climate Denier Studies


Important Insights:

OO How The Sahara Keeps The Amazon Rainforest Going

OO How Sahara Dust Sustains the Amazon Rainforest, in 3-D - via an atmospheric pipeline, supplying the Amazon, with a crucial source of phosphorus, a vital nutrient. If climate change disrupts this source, massive biological changes could occur to the forest.

*

OO Signs Of Spring 'Shifting' In Trees

OO Scientists Witness Carbon Dioxide Trapping Heat In Air - what the physical laws of nature say must be so, has now been witnessed in the atmosphere above the United States, chronicling human-made climate change in action, live in the wild.

Dancing Towards Understanding

OO Australia: How Indigenous Dance Can Change
The Way We Understand Climate Change
- by appealing to feelings on climate change.

2015-03-02-ArmitageOnTheNatureofThingsCreditJulietaCervantesccr266.jpg

A new dance production on climate change by Karole Armitage will premiere in New York City, March 25th at the American Museum of Natural History.

@@ ON THE NATURE OF THINGS March 25-27, 2015, 8:00pm $25-35
The American Museum of Natural History, The Milstein Hall of Ocean Life
Tony nominated choreographer Karole Armitage will premiere a new site-specific dance production about climate change and its cultural context, created specifically for the Museum's Milstein Hall of Ocean Life. Check it out!

* * *

WHAT DOESN'T WORK

2015-03-09-1425909994-3546202-frackinghydroaaerialviasafewatermovementorgcctw95.jpg
The aerial face of fracking on Earth. Source: safewatermovement org

Fossil Fuel Follies

OO Fossil Fuel Industry Manipulates Science says a new analysis by a watchdog group of over 130 documents distributed to policymakers by industry representatives.

OO San Francisco Bay Area Workers, Unions, Finance The Fracking Boom via their pension funds, even though they are increasinly joining the climate justice movement.

OO Fracking Opponents Feel Police Pressure In Some Drilling Hotspots

Waste:

2015-03-09-1425910067-1723325-foodwastesourcebiocycle.netccr267.jpeg
Source: biocycle.net

OO Food Waste Contributes to Climate Change
And Cost Billions Yearly
says a new report.

Clueless Leadership

OO Arizona: Utility Board Approves Large Monthly Solar Fees - likely to discourage solar power in a sunny state... go figure.

* * *

WHY WE SHOULD ACT NOW: RISING RISKS extreme weather, California dryin',
Google Weather around the world month year to get latest update from Jon Plotkin; ck the summary.

2015-03-09-1425910130-719325-anomaltempmar082015.png


Daily Climate Change: Global Map of Unusual Temperatures, Mar 8, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

OO A February First: Planetary CO2 Levels Pass 400 PPM Milestone - while many experts have said that 350 ppm and above allows the development of dangerous climate change.

2015-03-09-1425910201-5616677-toohotortoocoldUSmapoffeb2015weatherccr267.png


A Historical First: 2 Consecutve Record -Warm Winters in California are caused by a stable high pressure ridge just off the California coast reports Andrea Thompson at Climate Central. The ridge, in turn, is likely fueled by the extremely warm Pacific waters beneath it, says a NOAA climatologist.

Since ocean temperatures change very slowly, though, don't expect the ridge - or hot dry weather - to end anytime soon. Meanwhile, the state's water storage system, the snowpack, is at near-record low levels. The drought continues...

OO Global Warming Upped Heat Driving California's Drought

OO Sea Levels In Northeast US Jumped 5 Inches In Just 2 Years study finds.

2015-03-09-1425910316-695407-Australiaheatsup50020130711.png

OO Global Warming Will See Australian Deserts Grow Bigger - says a new US study; not good, given how much desert already exists there.

Social Repercussions:

2015-03-09-1425910424-103855-LakeMeaddrought500SourceTheDailyClimateccr267.jpg
Lake Mead. Source: The Daily Climate.

OO As The River Runs Dry, I: The Southwest's Water Crisis

OO As The River Runs Dry, II:
Southwest US Urban And Rural Water Users Battle

OO Massachusetts May Cut Coastal Building
As Costly Storms Take Their Toll
and even worse is predicted in coming decades.

2015-03-09-1425910495-8014423-predictedwarmingviaNASAstudyccr267.png
See all those dark brown areas? Under business as usual, US carbon emissions will likely create severe droughts in the US, Mexco and Central America by 2095. Via NASA

OO Carbon Emissions to Dramatically Increase Risk of Megadroughts
from US to Central America
says NASA report.

OO Immigration Crisis in the Making? If, as a major carbon emitter, the US is responsible for making Mexico and Central America, are we ethically obligated to accept these new climate change refugees into the US? Asks Joe Romm at Climate Progress.

2015-03-09-1425910619-9352742-coralbleachinggreatbarrierclimateshifts.org.png
The face of climate change on coral: bleached of life. Source climateshifts.org

OO Florida: Global Warming Fuels Coral Killer worsening a disease that has almost wiped out Caribbean coral reefs, says a new study.


OO US Oyster, Clam Industry Face Economic Blow From Acidification says a new study... no more oysters on our menus?

OO Pacific Islands: Tomorrow's Climate Refugees Struggle To Access Water Today

2015-03-09-1425910677-1026837-coffeecupofwikipediacctw96.jpg
Get your coffee while you can! Coffee crops worldwide are threatened by disease and heat worsened by climate change. Wikipedia.

OO UK: Famous Botanical Garden Searches For Coffee
That Will Survive Climate Change

OO Malaysia: Climate Concerns Penang Fisheries as eroding coastlines send polluting sand and soil into coastal fisheries.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-03-09-1425910764-5190790-deforestationforpalmoilinBorneomongabay.jpg

OO Tropical Forests May Be Vanishing Even Faster Than Previously Thought - the rate of loss increased over 60% from the 1990s to the 2000s, says a new study.

OO Peru's Protected Areas Aren't Where They Should Be - and are not adequately protecting many Peruvian species, a new study finds.

OO Researchers Propose Improvements For Peru's Protected Areas

2015-03-09-1425910839-9484302-Borneoselectiveloggingoftencompletelytransformsforestmongabayccr237.jpg
Even selective logging often completely transforms a forests. Source: mongabay.com

OO Malaysia: Corruption Allows Illegal Logging To Destroy Sarawak Forests says a new report.

OO Biofuels Are Bad News For Forests, Climate, Food Security says report.

OO Brazil Arrests 'Amazon's Biggest Destroyer' of forests.

2015-03-09-1425910928-8692746-Tacananativeshowstouristshow2settrapCreditBarbaraFraseratmongabay.comccr267.jpg
A Tacana shows tourists how to set a trap. Credit: Barbara Fraser

OO Partnering For Conservation Benefits Tacana People, Bolivian Park

OO Santander Bank Cuts Off Majro Pulp n Paper Company, Due To Deforestation

2015-03-09-1425911019-1588928-pantherchameleonAnkaranaReserveMadagascarccr267.png
Protected areas like the Ankarana Reserve in Madagascar are important holdouts for threatened species, like this panther chameleon.

OO World's Protected Areas Receive 8 Billion Visits Yearly,
But Still Underfunded
yet these 140,000 areas likely brought in at least $600 billion to national economies, new research reveals.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this peach blossom I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: US Kabooming, Solar Winning, and More!

(0) Comments | Posted March 2, 2015 | 3:42 PM

Today, the Earth got a little hotter, and a litte more crowded.

@@ Climate Change, The Elevator Pitch: Climatologist Simon Donner

@@ How To Combat Climate Denial: the Online Course where you can see the above video and many more interviews at the new Skeptical Science Massive Online Course (MOOC) on climate denial; you can sign up here.


2015-03-02-ArmitageOnTheNatureofThingsCreditJulietaCervantesccr266.jpg

A new dance production on climate change by Karole Armitage will premiere in New York City, March 25th at the American Museum of Natural History.

@@ ON THE NATURE OF THINGS March 25-27, 2015, 8:00pm $25-35
The American Museum of Natural History, The Milstein Hall of Ocean Life
Tony nominated choreographer Karole Armitage will premiere a new site-specific dance production about climate change and its cultural context, created specifically for the Museum's Milstein Hall of Ocean Life. Check it out!

OO Dear Alaska: We Have Your Air. Please Come Pick it Up. And Bring us Back Ours. Love, Eastern US.
2015-03-02-depression466fromdisastersMaxBoschiniatflickrccr240.jpg Credit Max Boschini at flickr

A Perfect Storm of Population and Climate Change: Water Rationing and Riots have begun in cities, especially in developing countries like Pakistan, reports Michael Specter in the New Yorker. Climate change has disrupted increasingly the natural global distribution of water into floods and droughts, as human populations have increased exponentially. So will social disruption, unless we confront both imbalances soon, and fast.

2015-03-02-palmtreesundercutbyrisingtidesfunnelogychannelatinstagrameverydayclimatechangefeb272015ccr266.png
Credit funnelogy at instagram

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

Palm Trees Imperiled by rising water levels on Siargao Island, Philippines, where they are no longer supported by the soil that they grew from, now washed away by the tide.

The coastline is being carved deeper and deeper by powerful waves as palm trees tumble down, one by one.

The island is doing its best to adapt by protecting its wealth of mangrove swamp forests.

*
*
*

SOLAR KEEPS FLYING

2014-12-30-Solarkeepsflying500SolarplanethesolarimpulsecourtesyofSolarImpulse.jpg

OO Getting Everyone Involved:
Major US Solar Companies Announce Workforce Initiative
- to diversify the force both in gender and economic backgrounds.

OO Solar Energy's New Best Friend Is ... The Christian Coalition - as Christians note their mandate of preserving God's creation and their children's future.

OO Buyers Will Pay More For Homes With Solar Panels says a new study.

2015-03-02-Solarhomesale310xresaleSourceGreenTechMediaccr261.jpg Source GreenTechMedia

OO How Do You Know Your Solar Panels Are Working Correctly?
You Probably Don't
- many homes have malfunctioning or even non-functioning systems, a study found, despite meters that tell owners how the system is performing.

OO San Diego, CA Utility to Expand Solar-Power Microgrid
With a $5 Million State Grant

OO San Antonio, TX: Offer Free Electricity For Using Rooftops as Solar Power Sources - is the tack for a pilot utility program to spread solar rooftops into lower income communities.

2015-03-02-indiasolar620villageviaclimateparliamentatclimateparlnet.jpg
Source climateparl.net

OO Decentralized Renewables Set for 70% Annual Growth in India says a new report.

OO India Starts Building World's Largest Solar Plant, Overtaking U.S. - the 750 MW project could ultimately power some 2 million households.

OO Bangladesh Aims to Be the World's First Solar Nation via rooftop solar mainly, says the government, with financial assistance from the World Bank and others.

2015-03-02-TanzaniasolarhomeTimMcDonnelltheClimateDeskatMotherJonesccr266.jpg
This man uses his solar panels (visible on the roof behind him) to power up villagers' cellphones. He charges them for 12 cents apiece. Credit: Tim McDonnell/the Climate Desk

OO These Tanzanian Villages Don't Have Plumbing -
They Have Solar Power

OO One Million Solar Homes - Tanzanian Style - means designing, building and installing solar panels, lighting, batteries and a meter in an off-the-grid home, which is then paid in installments as cheap as twenty cents a day. It's a model that might light up Africa.


2014-01-31-geostellargetcleanenergy.png

Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO Deutsche Bank Seeks to Buy $1 Billion in Green Bonds

OO Citigroup Sets $100 Billion Funding Goal for Green Projects

OO Influential Financiers, From Warren Buffett To Bill Gates,
Are Divesting Fossil Fuels


2015-03-02-UniversityofColoradoSourceUniversityofColoradoccr266.jpg
A campaign to get universities to stop investing in greenhouse gas-producing fuels has come to the University of Colorado requesting it divest from coal and petroleum companies. Source: University of Colorado

OO Fossil Fuel Divestment Effort Comes To Colorado - as activists ask the university to divest.

OO Michele Bachmann Inspired Factcheck.Org
To Debunk Lies About Science
- finally, Michelle inspires truth, even if she has no idea what it is.

OO Oil Price Drop Won't Derail Climate Push, Says White House

2015-03-02-applecarconceptSourceosxdaily.comccr266.jpg
Source, osxdaily.com

OO Apple Gears Up to Challenge Tesla in Electric Cars

OO Utilities Expand Into Charging Stations For Electric Cars

<<< Big Bad Batteries!! >>>

OO Vanadium Flow Battery Aims to Compete With Lithium and Lead-Acid at Grid Scale

OO Advances in Lithium-Sulfur Batteries Offer Promise for Electric Cars

2015-03-02-windoffshorefarmbalticviathehuffingtonpostdec2013cctw90.jpg
Huffington Post

OO U.K. Approves World's Largest Offshore Wind Farm

* * *

WHAT WORKS

Speaking Out:

OO Harvard Prepares To Fight Fossil Fuel Divestment Case In Court - as students represent themselves and future generations of Harvard students in the fight for a decent future.

OO BP: Huge Rise In Energy Demand At Odds With Climate Change Fight - but is BP really going to do anything about it? Ha!


OO Catholics Around The World Will Fast For Climate Action During Lent

2015-03-02-BillNyeonBillMaherclimateskepticsaredeniersccr266.png
Bill Nye on the Bill Maher show. screencapture

@@ Video: Bill Nye: Let's Be Honest, Climate 'Skeptics' Are Just Deniers

OO World's Biggest PR Firm Calls It Quits With American Oil Lobby - despite a multi-million dollar relationship.

2015-03-02-vegetablemarketsectionSourceTheDailyClimateccr266.jpg
Source: the Daily Climate

OO Americans Should Consider Eating Less Meat
For Environmental Reasons, Scientists Say

OO Scientists, Policy Experts: Time to Phase Out Carbon Emissions Entirely


OO State Lawmakers Push Electric-Car Ownership With Bevy Of Bills


2015-03-02-futuresouthwestmegadroughtscenescollageccr265.png
Future US landscapes?

OO NASA Study Warns Of Unprecedented North American Drought

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies:

OO Huge Explosion Rips Through California Oil Refinery,
Adding Fuel To Oil Worker Strike

2015-03-02-solarvsfossilfuelsoil2ccr266.png
Which Fire Do YOU Prefer? A serious accident - fire, explosion, toxic release - happens almost weekly in a US oil refinery. Electricity from solar power could power cars and heat homes instead.

"Take a gallon of gasoline. Close it up. Put it on a hot barbecue grill. Multiply that by a million. That's a refinery."

Oil Refinery Safety Expert Kim Nibarger testifying before Congress, 2013


YOU CAN ACT : Oil workers are 6 times more likely to die on the job than the average American. http://inthesetimes.com/working/entry/17623/oil_strike Demand safe working conditions at oil refineries now.

Then resolve to personally divest from oil: get rooftop solar panels and an electric heater, for starters.


The BP ad spoof that tells it like it is ... enjoy!

OO Fed Predicts Up To 10 Derailments A Year Of Fuel-Hauling Trains

OO California: Health Concerns Mount After Refinery Explosion
Coats City With White Ash

Exposure to amorphous silica, which Exxon said the dust was composed of, is associated with an increased risk for inflammation, granuloma formation and emphysema..


2015-03-02-fireballfromderailmentoftraincarryingoilinWVAfeb2015sourceDailyClimateccr266.jpg
Source Daily Climate

OO West Virginia In State Of Emergency After Massive Oil Train Explosion

Related Headlines:

OO West Virginia Oil Train Derailment Sends Crude Tanker Into River

OO Train Carrying 3 Million Gallons of Crude Still Burning

OO After W Va Explosion, Oil Trains Rerouted Through Virginia Towns

2015-03-02-oildisastersCreditAndrewBreinerimagesfromAPShutterstockCTVccr266.jpg
Credit Andrew Breiner, images from AP, Shutterstock, CTV

OO Four Oil-Related Spills Reported In North Dakota -
Latest In A Week Of Oil Mishaps

OO Bill Gates Still Ignores Climate Change --
It Will Undo His Foundation's Work

2015-03-02-coalashdumpsinNCarolinaownedbyDukeEnergySourceTheDailyClimateccr266.jpg
Source: The Daily Climate

OO US Charges Duke Energy With Illegal Pollution From 5 Coal Ash Dumps

OO India's Air Pollution Is Cutting 3 Years Off Residents' Lives -more than half of the country's population live in regions with high levels of air pollution, a new study has found.

Misleading the Public:

*
*

2015-03-02-WeiHockSoonclimateskepticscientisthidtiestofossilfuelsponsorsSourceTheDailyClimateccr266.jpg
Wei-Hock "Willie" Soon, a scientist who promoted climate change as neither important nor manmade, listed his work as "deliverables" when billing fossil fuel companies that paid him to write climate doubting papers, discovered documents show. He often violated ethical publishing guidelines by failing to disclose his ties to these companies. Source: The Daily Climate

OO Contrarian Scientist Is Accused Of Taking Corporate Cash For Science - Willie Soon: "no amount of money can influence what I say or do or research or write." If recently released documents are accurate, he is a liar.

Related Headlines:

OO Deeper Ties To Corporate Cash For A Doubtful Climate Scientist


OO Documents Reveal Fossil Fuel Fingerprints On Contrarian Climate Research

2014-07-06-populationmatters2green.png

OO Taps Start To Run Dry In Brazil's Largest City - São Paulo water crisis is linked to growth, leaky distribution, climate change, and deforestation, and now officials contemplate evacuation.

OO As China Gets Richer, The World Gets Dirtier,
Via the Momentum of Over One Billion People
- not surprising, especially as much of its one billion people rise above poverty and start consuming like the rest of the developed world, via rapid industrialization, the same process that has made it a major contributor of greenhouse gases.

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2015-03-02-anomaltempmar022015.png

Daily Climate Change: Global Map of Unusual Temperatures, Mar 2, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US lower 48 are colder than normal, although the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot has drifted south and north of the California coast, but little rain is reaching the state, sending it into further drought.

Much of the areas surrounding the North Pole, including Alaska, are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

And The Heat Goes On...

OO USA, January & February 2015:
Vastly More Daily Warm Records Than Cold Ones

OO Hottest 12 Months On Record Globally Thanks To Warm January,
Reports NASA

2015-03-02-winter2015snowfallSourceClimateCentralccr266.jpg
US 2015 winter snowfall to date vs the average.

OO Dry or Snowy? Extreme Winter Weather Splits Much of U.S.


OO Sea Ice Still Declining, Despite Antarctica's Gains

2015-03-02-sealionsinCASourcetheDailyClimateccr266.jpg
Source, the Daily Climate

OO California Sea Lion Deaths: Warmer Seas May Be To Blame which can affect vital things like food sources.

2015-03-02-lemurstoprowwikipediaccr266.jpg
Many of Madagascar's lemurs are endangered from deforestation; now climate change threatens them further. Wikipedia

OO Climate Change Threatening Madagascar's Endangered Unique Lemurs - already declining from rampant deforestation and poaching, the lemurs will be further devastated by climate change.

.
Social Repercussions:

2015-03-02-oceanacidityeffectssocialandmarineNRDCviaccentralccr266.png


Climate Change Threat to US Seafood and Fishing Economies Is Rising as ocean acidity rises, reports Brian Kahn at Climate Central, and a new study analyzes how this will affect US coastal economies.

OO California Water Becomes Scarce and Energy Hungry - as the continuing drought forces much more energy to be used to pump water from groundwater rather than surface water supplies, such as rivers.

OO Climate Change To Make Infectious Disease Outbreaks More Frequent

2015-03-02-corncropinEuropecreditH.RaabatFlickrccr252.jpg
Credit H. Raab at Flickr

OO Climate Change Hampering World Food Production - profound societal changes will be needed in coming decades to feed the world's growing population, researchers at an annual science conference said. Like changing family size, humanely?


2015-03-02-sealevelrise490gifsourceclimatecentralccr240.jpg
Source: Climate Central

OO Rising Sea Levels And Temperatures Ahead For NY City

OO Global Warming Could Make
NYC Super-Rich Jealous Of Row House Residents
- as reports project what would happen if city buildings lost power in extreme heat and cold.


OO SF, CA: King Tides At Candlestick Point Offer Glimpse Of Planet's Future - As recent king tides washed over a small beach there, San Francisco Bay became a classroom for teaching the grim reality of sea-level rise.

OO Early Start To US West Wildfire Season - over the last forty years, the fire season has more than doubled across the West, now spanning 7 months or more.

2015-03-02-floodingsunderbansBangladeshSourceaidindia.orgccr266.jpg

Source AidIndia.org

OO Millions At Risk From Rapid Sea Rise In Swampy Sundarbans - seas are rising more than twice as fast as the global average in this low-lying Bengal Bay delta of 200 islands, where some 13 million impoverished people live.


2015-03-02-sardinesMeditstaplemigratingtowarmerwatersaTheDailyClimateccr266.jpg
Climate Deniers Fail To Convince Sardines, Which Vote With Their Fins - the Mediterranean food staple is swimming north to cooler waters. Source: The Daily Climate

OO Sardines Swim North To Keep Cool - and escape warming seas, leaving Mediterranean fishermen with empty nets.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

OO Indonesia To Squander Fuel Savings On Biofuel Subsidies
That May Drive Deforestation
, say environmental groups.

YOU CAN ACT


2015-03-02-orangutanIndonesiandeforestationforbiofuelsphotomontageSOBIARIndonesiaRANccr266.jpg
You cut down my home for fuel? Tell the Indonesian president here to stop this gift to the deforesting palm oil industry.

Threats:

OO New Guinea Rainforest Being Leveled For Palm Oil - revealing gaps in zero deforestation pacts.

2015-03-02-chimpsendangeredEastAfricaCreditRhettButlerccr266.JPG
Many endangered chimpanzees in East Africa live in habitat threatened by oil palm expansion. Photo by Rhett A. Butler.

OO Scientists Sound The Alarm On African Palm Oil Investment

OO Chinese Banks Funding Rainforest Destruction In Indonesia

2015-03-02-ParaguayindigenousAyoreohomeabandonedfrombulldozerccr266.jpg
Paraguay: A traditional communal Ayoreo house that was abandoned because of bulldozing activity. Photo courtesy of Survival International.

OO Paraguay: Indigenous Communities Threatened By Deforestation,
Despite Having Land Rights

Solutions:

OO Campaign Asks Consumers To Directly Support Forest Conservation

2015-03-02-forestfrogsbiodiversityCreditGuiBeckeratmongabayccr266.jpg Maintaining healthy biodiversity could reduce the threat of disease from wild habitats worldwide, a new study indicates. Credit Gui Becker at mongabay

OO Biodiversity May Reduce The Threat Of Disease

OO Indonesian Forestry And Fishery Ministries Move To Eradicate Corruption

2015-03-02-GuyanaforestCreditTiffanyRoufsccr266.jpg
Credit Tiffany Roufs at Mongabay

OO Local Technicians Effective At Forest Monitoring study finds.

Insights:

OO Brazil: Land Threatened By Dam Projects Belongs To Indigenous Munduruku Tribe - confirms the independent foundation, Funai.

2015-03-02-MundurukuindigenousnativePeruCreditMarcioIsenseeeSatmongabayccr266.jpg
Brazil: A Munduruku indigenous native. Credit Marcio Isensee e Sá at mongabay

OO Dams Or Indigenous Land: The Battle Over The Munduruku Frontier -The Munduruku indigenous tribe are marking their land boundaries , in an action that could halt Brazil's giant São Luiz do Tapajós hydroelectric dam,, which would flood this sacred land. 'We are not leaving,' says the village chief.

OO Selective Logging Causes Long-Term Changes To Forest Structure


There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by thesegentian I photographed one summer. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-03-02-DSCN0236Gentiandancing.jpg...
Read Post

Climate Change This Week: Apple Goes Solar, Apocalyptic US Droughts Predicted, and More!

(0) Comments | Posted February 23, 2015 | 2:45 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Deadpan Climate Humor At Its Best:
Philomena Cunk Moments of Wonder - Climate Change
- of course, one can easily imagine some US voters really believing that coal comes from dinosaurs - and that burning it has made dinosaurs rare... Philomena played by the talented comedienne, Diane Morgan.

*
*

2015-02-23-futuresouthwestmegadroughtscenescollageccr265.png
Likely future scenes of the US Southwest and Great Plains, as scientists predict the worst megadroughts in the past 1000 years to unfold from 2050 onwards, as a result of global warming.

US Southwest, Great Plains Could Soon Face Worst 'Megadroughts' In Modern History, study finds, reports Ari Phillips at Climate Progress. The NASA/NSF funded study builds upon recent research, predicting megadrought conditions, starting by 2050, that will far surpass even the worst southwest medieval megadroughts thought to have caused the downfall of ancient Native American civilizations, such as the Pueblos.

The extreme results surprised even the study researchers.

2015-02-23-tolesdroughtcartooncolorTomTolesattheWashingtonPostccr265.jpg
Tom Toles at the Washington Post

Related Headlines:

OO Droughts Will Hammer US West As 21st Century Unfolds

OO U.S. Central Plains, Southwest Likely Face Apocalyptic Drought

OO Southwest, Central Plains Face 'Unprecedented' Drought

*
*

2015-02-23-BostonsnowcoverscarsFeb2015CreditStevenSenneAPphotoccr265.jpg
Boston, February 2015: I know my car's around here...somewhere... Credit Steven Senne, AP photo

OO As Boston's Crazy Snow Keeps Falling,
Scientists Weigh In On Climate Impact

"All weather events are affected by climate change because the environment in which they occur is warmer and moister than it used to be." --Kevin Trenberth, IPCC climate scientist

Related Headlines:

2015-02-23-Arcticaneurismexplainedmehccr265.png

OO Cold Air Invasion Coming: What's the Role of Warming?

OO Weird Winter Weather Plot Thickens As Arctic Swiftly Warms

OO Global Warming May Be Affecting Jet Stream - A winter of strange weather and turbulent transatlantic flights in the northern hemisphere has scientists asking: Has a predicted climate imbalance of the jet stream begun?

@@ The Climate Change Elevator Pitch: Ken Caldeira

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

2015-02-23-climaterefugeeofSomalidroughtCreditMatildeGattoniatinstagramccr265.png

February 21, 2015: Sarura Aden walked for 25 days across the Somali desert to a crowded, unsanitary and undernourished refugee camp in Kenya, witnessing the killing of other refugees by militia and wild animals, as she fled a tremendous drought that had destroyed all of her livestock and her way of life. Credit Matilde Gattoni at Instagram

2015-02-23-pollutingpowerplantinFloridaWalteratFlickrccr265.jpg Credit Walter at Flickr

Paris Climate Pact To Rely on Peer Pressure, Cooperation, Not Coercion reports John Upton at Climate Central. Having failed at forcing countries to achieve needed carbon cuts within specific time frames, the UN will now focus on a process that includes national accountability instead. Will it succeed? Stay tuned.

More Warming Woes for Corals:

2015-02-23-crownofthornsstarfishWikipediaccr265.jpg
Crown of Thorns starfish are big suckers and can devastate coral reefs. Wikipedia

OO Great Barrier Reef: Warmer Waters Helping Coral-Eating Starfish Thrive

OO Warmer Oceans Helping Coral-Eating Starfish Thrive

2015-02-23-FutureArcticbyEdwardStruzikbookccr265.jpg

OO Arctic Upheaval: new book outlines challenges at the top of the world

*
*
*

SOLAR KEEPS FLYING

2014-12-30-Solarkeepsflying500SolarplanethesolarimpulsecourtesyofSolarImpulse.jpg

OO The Carolinas Have Become Hot Spots for Solar Market Expansion

OO Duke Energy Proposes $69M Investment in South Carolina Solar

OO Massachusetts: the Second-Biggest Employer for Solar Power

2015-02-23-applesolarsun.png

OO Apple Plans $850Million Solar Plant With First Solar
To Power All California Operations

Related Headline:

OO Apple Deal, Tax Change Could Spark Corporate Solar Stampede of contracts driven by the looming change in a solar tax incentive that makes such projects particularly attractive.


OO The Great Solar Panel Debate: To Lease or To Buy? read who did which, and why.

2015-02-23-DesertSunlightfarmCreditUSATodayScreenshotccr265.jpg
Credit USA Today, Screenshot

OO One Of The World's Largest Solar Energy Farms Opens In California

Related Headline:

OO Solar Farm Capable Of Powering 160,000 Homes Opens In California


OO Minnesota: Regulators Approve Projects That Will Boost Solar Power There 10x


OO U.S. Companies Pledge To Build 20 GW Of Renewable Energy In India

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

OO Judge Halts Use Of Eminent Domain On Nebraskans For Keystone Pipeline


OO Fed Report: Gas Can Replace Coal Plants, Supporting Obama Climate Plans

2013-11-28-EnergyStarColorLogo.jpg


OO EU Energy Consumption Level Falls To 20-Year Low

OO "Stop Me Before I Kill the Planet":
Another Major Oil Producer Calls for Carbon Pricing

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO Google Buys Altamont Wind to Power Its Headquarters,
Surpassing 1 GW in Contracts

OO Germany Leads Record Wind Power Growth in Europe

2015-02-23-climatelibeljusticeSourceShutterstockatClimateProgressccr265.jpg
Source Shutterstock

OO Climate Scientist Wins $50,000 In Libel Lawsuit
Against Conservative Newspaper
- as the judge notes that the paper can be skeptical about climate science without creating misleading or false statements about scientists.

OO Tesla Plans Battery for Household Energy-Storage Market

<><><>

OO Obama Looks to Raise $2 Billion in Climate Change Investments

OO US Factories Are Polluting Way Less As They Clean Up Their Acts as environmental rules emerge.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO New York Times: Those Who Deny Climate Science Are Not 'Skeptics'

2015-02-23-antigeoengineeringgraphicsourceclimateprogressccr265.jpg
Source: Climate Progress

OO US National Academy: Forget Geoengineering - Even The Term Is Misleading since " 'engineering' implied a level of control that is illusory." The two academy reports concluded "There is no substitute for dramatic reductions in the emissions of CO2."

OO President Obama Emphasizes Cold Hard Truth About Climate Change

OO Ranking The Best And Worst Companies In Terms Of Deforestation - assessment ranks more than 400 companies, banks, investor, and other powerbrokers by the extent and scope of their sourcing policies for six 'forest risk commodities': soy palm oil, beef, leather, timber, pulp and paper.

Related Headline:

OO Chinese Companies Named And Shamed On List Of Deforestation 'Power Brokers'

OO Greenpeace Targets Banco Santander for Financing a Controversial Logging Company

Important Insights:

OO Warmer Seas Linked To East Coast Hurricane Outbreaks

2015-02-23-Castillejabouquet500wBenBlonder.png
A subalpine wildflower meadow in the Colorado Rockies is the site of the first and longest running global warming field experiment in the world. Credit Ben Blonder

OO 23-Year Global Warming Field Experiment Now Finds
Global Warming Impacts Already Underway
Full disclosure: the lead researcher, John Harte, is my husband.

OO Why Climate Scientists Are Right About How Hot The Planet Is Going To Get - historical evidence in sediments now back them up, a new study shows.

OO Fossil Fuel Pollution Decreased Rainfall In Central America - by shifting a vital rainfall belt south, says a new study that examined a 450 year old record rainfall and temperature.

2015-02-23-personreadingnewspaperpublicunderstandingclimatesourceTheDailyPlanetccr265.jpg
Source: The Daily Climate

OO Human Brain, Media Not "Wired" For Climate Understanding say 2 leading Australian scientists, and reporting all sides of a story often results in public confusion rather than clarity... maybe it has something to do with presenting all sides as if they all have equal legitimacy.

Good Ideas:

OO Save Mangroves: They Save Coral Reefs and Coasts
From Climate Change
- say federal scientists, who focus on how these coastal swamps can save our declining reefs.

2015-02-23-smartwindowviaheatgelSourceWangetalIndustrialandEngineeringChemicalResearchjournal2014ccr265.jpg
Source Wang et al, Industrial and Engineering Chemical Research journal, 2014

'Smart' Windows Could Save Energy Tiny droplets of a heat sensitive gel sandwiched between glass panes turn cloudy when it's hot outside, filtering out some warming sunlight, an improvement over current electronic versions, reports Sid Perkins at Student Science.

OO Want to Save money on your energy bill? There's a game for that.

OO Getting More Restaurants To Go Carbon-Neutral - begins the minute the customer walks through the door.

Informed Leadership:

OO UK's Three Party Leaders Sign Joint Climate Pledge

OO California Lawmakers Introduce Major Package Of Bills To Tackle Climate Change

OO Leading in Cleaning Up Trucking:
A Young Green CEO of a Big Company
- in trucking, worth $100 million.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

2015-02-23-frackingrigspossiblyOklahomaCreditShutterstockccr265.jpg
Credit Shutterstock

OO Small Earthquakes Linked To Fracking Could Lead To Major Ones - says a government scientist.

OO Canada: Oil Train Derails, Spills Unknown Amount Of Crude Oil

2015-02-23-bottlenosedolphinSourceyoumeanbiodiversity.wordpress.comccr265.jpg

Source youmeanbiodiversity.wordpress.com

OO Unusual String Of Bottlenose Dolphin Deaths Linked To BP Oil Spill

Dangerously Dumb Ideas:

OO Climate Hacking, aka Geoengineering, Is Barking Mad

OO Biofuel Goals Could Require All the World's Crops - which is just how much of a nonstarter it is, made in the 2008 free, downloadable book, Cool the Earth, Save the Economy.

2015-02-23-DeepwaterHorizon500_fire_20100421wikipedia.jpg

OO Oil And Gas Companies Won't Have To Pay For Damage Caused To Louisiana's Coast,
Judge Rules
- the world is theirs to exploit and trash without blame... thanks, judge.

OO Elon Musk Is Right: Hydrogen Is 'An Incredibly Dumb' Car Fuel - requiring far more mass and volume of the car, not to mention far lower efficiency in energy conversion.

OO Scientists: No, We Can't Fight Climate Change By Burning Trees - because trees are the cheapest way to store carbon, and burning them adds to greenhouse gases... duh. Why did the EPA create a memo even hinting at such folly as burning trees for energy?

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png

OO GOP House Passes Keystone Pipeline Construction Bill
Despite Obama's Opposition

OO GOP Senators Debate Whether Climate Change Is Real
At EPA Carbon Rule Hearing
- despite the overwhelming evidence and the agreement of reputable scientists that climate change is real. Your tax dollars and votes at work, folks!

2014-07-06-populationmatters2green.png

OO Big Cities Head For Water Crisis As Populations Explode - and the resulting climate change creates ever worsening droughts.

OO Populations Clash With Forest Conservation Via Agriculture

OO Borneo: Populations Clash With Forest Conservation Via Hunting

2015-02-23-oceanplasticonturtleCreditprojectgreenbag.comccr265.jpg
Credit: projectgreenbag.com

OO How Did We Ruin The Oceans? 7 Billion People, That's How - the climate-changing and chemical pollution of the oceans and voracious appetites of exploding populations are fueling dramatic changes and extinctions of marine animals and ecosystems, warn scientists.

2015-02-23-globalpopulationspeakoutgraphic2ccr265.png

*** YOU CAN ACT ***

Global Population Speak Out 2015 - pledge to become a Population Speak Out activist, raising public awareness in a variety of ways, including your own.

OO Population Taboo -- Kiss It Adieu! Dave Gardner of Growthbusters.org gives a good 2010 summary of why we need to speak out.

@@ The Most IMPORTANT Video You'll Ever See, Part I - Human populations are growing exponentially... see what this means for human survival.

* * *
WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-23-anomaltempfeb222015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 22, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US is experiencing colder than normal temperatures, while surrounded by abnormally warm waters. The increased moisture from the warm waters combines with the cold to produce record breaking blizzards in the northeast. Meanwhile, the abnormally warm eastern Pacific continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole, and the North Pole itself are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions:

2015-02-23-apocalypsevolcaniceruptionbyFranciscoNegroniccr265.jpg
A nearby volcanic eruption is evocative of the apocalypse. Credit: Francisco Negroni

OO Extreme Climate Change Tops List of How Civilization Will Most Likely End in a report created by Oxford scientists based on research. The other 11 global risks include everything but the obvious: too many people, which fuels many of the named risks.

* * *


OO Pennsylvania Vs. Climate Change: Lyme Disease Becomes Epidemic

OO Climate Change Threatens Future Of Australian Outdoor Summer Sport

2015-02-23-liftoffatKennedySpaceCenterCreditJatkinsatWikimediaCommonsccr265.jpg
Credit Jatkins at Wikimedia Commons

OO Researchers: Rising Sea Levels Having Effects At Kennedy Space Center

Natural Repercussions:

OO South America: Changes In Lakes Warning Signs Of Climate Change on other parts of the world, say researchers.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-02-23-loggingtruckinCamaroonCreditAmcajaatWikimediaCommonsccr265.jpg
A Camaroon logging truck full of murdered giants. Credit Amcaja at Wikimedia Commons

OO Illegal Logging Still A Big Issue In Cameroon

OO Zimbabwe Forests Under Threat

2015-02-23-forestnewlyclearedforpalmoilfarminSabahCreditRhettButleratMongabayccr265.jpg
Malay forest newly cleared for palm oil farm. Credit Rhett Butler at Mongabay

OO Illegal Logging Contributed To Deadly Malaysian Floods - says government minister.

OO Malaysian Authorities Failing To Take Action Against Poachers - wildlife is integral to forest health.

2015-02-23-milleniumtreeNewCaledoniaSourcewww.boardinggate101.comccr265.jpg Source www.boardinggate101.com

OO New Caledonia, SW Pacific: Ancient Majestic Trees Die Off, Near Extinction - no one reason can be pinpointed, but climate change appears to be fueling a few possible factors, including infestation, feral disturbance, and hot dry weather. These Millenium trees only start reproducing when they become 500 years old.


2015-02-23-chocolateswikipediaccr262.jpg
Where Do Your Chocolate Come From? Wikipedia

OO 'Sustainable' Cacao Company Allegedly Continues Deforestation to Farm


There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these crocuses I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-02-23-crocusespurple06_resize.JPG...
Read Post

Climate Change This Week: Norway Divests, Siberia Melts, and More!

(12) Comments | Posted February 16, 2015 | 11:09 AM

Today, the Earth got a little hotter, and a little more crowded.

OO Climate Change Elevator Pitch: Eric Rignot
of NASA's Jet Propulsion Lab is one of the globe's most accomplished glacier experts.

2015-02-16-HalibutAtlanticCreditJoachimS.MulleratFlickrccr263.jpg
Atlantic Halibut, a commercial fish. Credit Joachim S. Muller at Flickr

OO Climate Change Triggers Threats To Marine Ecosystems
A two-way migration of fish species between the northern Pacific and Atlantic as oceans warm could have drastic ecological and commercial impacts, as dramatic as when the Isthmus of Panama was open, thousands of years ago, which also allowed a Pacific-Atlantic exchange.

OO Global Warming Means Heavier Rain, and Snow:
Case in Point, Boston
- much warmer than usual sea surface temperatures helped double the local air moisture - and it all came down on Boston and beyond, shattering snow records... ignore the first video, which gets water vapor formation all wrong...


A Good Example of a Bad Science Video: Alluringly Simple -- and Wrong
"Why Global Warming Causes Bigger Storms"

Yes, warmer waters means more water vapor and ultimately heavier storms -- but the video gets water vapor formation all wrong. When water surface molecules heat up enough to break loose from other water molecules, they go into the air as water vapor. Expanding space between warming air molecules is irrelevant. Minnesota Public Radio, get your science right!

Now, if they had melted blue ice cream on top of the popcorn....

*
2015-02-16-rainwatercollectioninYemendroughtFeb132015matildegattoniatinstagramccr264.png

Matilde Gattoni
@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

A woman collects rainwater as the man-made water crisis grows in Yemen. Heavily dependent on oil revenues, due to dry up by 2017, its exploding population will double by 2035, and is rapidly outstripping its poorly managed and now scarce water supply. Poverty, mortaility, and unemployment are high: no wonder the country is a political mess.

2015-02-16-clarissathesolarpanelcartoon2CourtesyoftheTreeccr264.png
Clarissa the Solar Panel, by cartoonist First Dog on the Moon. Courtesy of The Tree, treealerts.org

OO The 2 Trillion Dollar Question, asks Clarissa the Solar Panel, is: why do we vote for leaders who fritter away $2 Trillion on climate changing fuels, when we now know there's a better way that's far cheaper?

* *

2015-02-16-birthcontrolpillsatDailyClimatefeb42015ccr264.jpg
source: Daily Climate


OO The Perfect Medicine for Climate Change: Birth Control, Say Experts - giving more women who want access to birth control to limit their family size - in both rich and poor countries could be a hugely effective way to curb climate change.

OO China Outcompetes US in Clean Energy Investments in 2014

* * *

SOLAR KEEPS DANCING

2015-02-16-solarkeepsdancingonthebeachatflickrccr260.jpg
Flickr

OO Off-Grid Solar Firms Raised $42 Million in the First Month of 2015 - that's two-thirds of what was raised in all of 2014.

OO Using Outer Space Ultra-High Efficiency Solar Cells on Your Rooftop to make a concentrated PV rooftop system is the latest breakthrough for a group of researchers.

OO Viriginia: Dominion V Power Plans 400 MW of Solar - as solar costs continue to decline, large-scale projects are the most cost-effective way to deploy solar power, the utility finds.

2015-02-16-solarhousesinHawaiicroppedNRELccr244.jpg
NREL

OO This New PG&E Program Will Allow Customers to Go 100% Solar

Related Headline:

OO California: Utility To Allow Customers To Get All Their Electricity From Community Solar

OO Minnesota's Great Leap Into Solar Begins - as legislation leads to an explosion in solar development.

2015-02-16-applesolarsun.png


OO Apple Plans a Solar-Powered Command Center in Arizona

OO World Bank Intends to Lend $500 Million
to Power Grid for Solar Infrastructure

OO China's Hanergy to Build Solar-Powered Cars -the market potential is huge, says the firm.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Wind And Solar Energy Have Tripled Since 2008 - clean energy progress has been immense on a number of fronts, says a new report.

Related Headline:

OO An Illustrated Guide to the State of America's Clean Energy Sector

Some Takeaways:

- oil and coal consumption have declined slightly; renewables have increased slightly
- wind and solar dominate the increase in renewables
- clean energy investment has increased 500% since 2004
- electric vehicle sales increased 25% in 2014, but still are less than 1% of car sales


OO US Government Energy Consumption at the Lowest Level Since 1975

2015-02-16-chinesedragongreenccr234.jpg
China continues to green itself.

OO China To Create Carbon Market And Cap Emissions

OO Norway To Cut Climate Pollution By 40 % By 2030 - but will it stop producing fossil fuels?

Related headlines:

OO Norway Sovereign Fund Drops Coal, Tar Sands, Gold-Mining Companies

OO World's Largest Sovereign Wealth Fund Dumps 40 Coal Companies

OO EU Policy-Makers Seek To Make Electric Transport A 'Priority'

Informed Leadership

2015-02-16-antifrackingphotoAPphotoMikeGrollccr257.jpg
AP Photo/Mike Groll

OO Fracking Moratorium Sought In Maryland

OO France to Ax Coal Subsidies While EU Stalls

*
*
*

WHAT WORKS

Speaking Out:

OO 14 High-Profile CEOs Want To Rid The Global Economy Of Carbon Emissions By 2050
"New jobs, cleaner air, better health, lower poverty and greater energy security."

2015-02-16-largestUSantifrackingdemonstrationprotestsofar350.orgfeb72015ccr264.jpg
8,000 strong in largest anti fracking rally in Oakland, CA despite rain. Source: 350.org

OO Health Sector Should Divest From Fossil Fuels, Medical Groups Say - just as they did with tobacco decades ago.

OO Health Care Industry Has Moral Obligation To Divest From Fossil Fuels, report argues.

2015-02-16-lobsterdinnerDSCN0865Aug2013MEHartea.jpg
The fate of Maine's lobsters is on the table.

OO Maine Report Warns Of 'Urgent' Need To Address Ocean Acidification
which threatens its lobster industry.

OO EPA Justifies Presidential Veto of Keystone Pipeline: Low Oil Prices, High Climate Cost

Related Headlines:

OO EPA: Keystone XL to Emit 1 Billion Extra Tons of GreenHouse Gases

OO EPA Gives Obama New Reason To Reject Pipeline: Low Oil Prices


2015-02-16-solarpanelsobamacredsolarpanelspowernet500.jpg
Source: solarpanelspower.net

OO Obama's New Budget Puts Billions Toward Fighting Climate Change

"The most costly thing we can do
is to do nothing,"

EPA Acting Deputy Administrator Stan Meiburg said.

2015-02-16-olympicrainforesttemperateforestRhettButlerccr260.jpg
Deforestation continues worldwide, even as recent research indicates that trees are the cheapest way to store carbon. Credit Rhett Butler at Mongabay

OO Scientists, Conservationists Call For More Inclusive Efforts To Save Forests

OO Wales Says No To Fracking Until 'Proven Safe' - just like Scotland and Ireland said.

OO Australia: Greens Call forAll Coal Mines to Close in New South Wales

Good Ideas:

2015-02-16-bulbs300energyefficiencyviaplusmathsorg.jpg Source: plusmaths.org


OO Low Energy Prices Offer Opening For Subsidy Cuts and governments in the Middle East and much of the developing world are doing so.

OO Money Versus Morals:
Why Economic Rewards Trump Polite Messaging in Efficiency
- money wins out, at least in Japan, in coaxing home energy efficiency gains.

<><><>

OO Low CO2 Emissions Tax Possible If Clean Technology Is Also Implemented

OO Lawmakers Propose Laws To Push Electric Car Ownership

Insights:

2015-02-16-arcticwaswarminPliocenefossilrecordsccr264.jpg
The Arctic was warm during the Pliocene.

OO Ancient Climate Records
Back Current IPCC Predictions
- yes, Virginia, the future climate is going to be just as disastrous as IPCC scientists predict, judging from our fossil records.

OO How Termites Hold Back The Desert, Fighting Climate Change - with massive mounds that provide a moist refuge for plants in a dry landscape.

2015-02-16-tornadoinCampoCO31May2010MattClarkatflickrccr238.jpg
Credit Matt Clark at Flickr

OO Global Warming May Spawn More Southeast US Tornadoes

OO Rise In Wildfires May Resurrect Chernobyl's Radiation - Climate change may help spur fires there that could release radioactivity locked in soils, letting them spread all over Europe. allow them to spread over Europe.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

OO Coal Companies Don't Pay Enough To Mine For Coal
On Federal Land, Report Says


2015-02-16-coralreefviaDailyClimate264.jpg
Source: Daily Climate

OO Great Barrier Reef Dredging Is Causing Major Damage, Study Finds From dumping fossil fuel waste coming from coastal ports; the reef has already lost half its corals over the past 3 decades from pollution and environmental hazards.

OO New York Banned Fracking, But 460,000 Tons Of Fracking Waste Have Been Dumped There

Clueless Leadership:

OO Australia: Wind Farms Face $13 Billion Wipeout From Political Impasse - as investments flee.

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-16-anomaltempfeb152015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 15, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought, while unusually cold temperatures in the northeast combined with unusually warm coastal waters contribute to massive blizzards there.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-02-16-atmosphericriverbringsrain2toCAJan2015ccr264.png

Global Warming Helps Block Atmospheric Rivers
That Water California
Atmospheric rivers have been mostly diverted from reaching California by a persistent high pressure Pacific system off California of the type predicted to occur under climate change in a 2005 study.

Not enough is known to predict why the high pressure system occasionally allows an atmospheric river to sneak in and water California, though reports Andres Thompson at Climate Central. The latest river is far from significantly easing California drought.

OO Winter Is Losing Its Cool Nights in US Cities - climate change is decreasing the number of below-freezing nights in most cities, even as it helps produce massive blizzards.

2015-02-16-meltingpermafrostcratersSiberiaCREDITFLICKRSTEVEJURVETSONccr263.jpg
Planetary Freezer Unplugged: Melting permafrost craters in Siberia. Credit Steve Jurvetson at Flickr

OO Climate Change Is Accelerating The Melting Of Siberia - one of the planet's largest storehouses of frozen greenhouse gases. Oh-oh.

OO A Fresh Look At Oceans Shows Earth's 'Unabated Planetary Warming'

2015-02-16-hottestyearstop10climatecentralccr264.jpg


OO UN's World Meteorological Organization Chimes In:
2014 As Hottest Year
- a little over 1°F above the next hottest year.

OO 14 Of The 15 Hottest Years On Record Have Occurred Since 2000, WMO Says

2015-02-16-pikaatdailyclimatefeb32015ccr264.jpg
These are super cute little guys, that give off high little peeps when alarmed. Source: Daily Climate.

OO Disappearance Of Bunny-Like Pika Linked To Climate Change

Social Repercussions:

2015-02-16-historicfloodinginAlbaniafeb22015APphotoHektorPustinaccr264.jpg
AP photo/Hektor Pustina

OO PHOTOS: Albania In State Of Emergency After Historic Extreme Flooding - the second worst on record.

2015-02-16-NewYorkcitymapw100ftseariseJeffreyLinnccr264.jpg Recognize the Big Apple? Just oa third of all glaciers have to melt completely for this to come true - and almost all glaciers are melting now...

OO Maps Show What Major US Cities Would Look Like With Future Sea Rise - created by Jeffrey Linn, aided by a background in geography and urban planning, they assume 100 or more feet of sea rise: not projected to happen by 2100, but it's likely that future children will face this and other disastrous problems, depending on how fast we stop carbon emissions.

OO Rising Temperatures Threaten US Mountain States

Related Headline:

OO Colorado: Climate Change Could Bring More Disease, Crop Damage, Fires
State-commissioned study sees 2.5 to 5.5-degree temperature increase by 2050.

2015-02-16-childslavecarryingwatersourcekazakhnomad.wordpress.comccr264.jpg A child slave carries water. source kazakhnomad.wordpress.com

OO Climate Change Pushes India's Poorest Children Into Slavery - Disasters resulting from climate change are pushing poor Indian families into poverty and children trafficking.

*
*
*

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-02-16-forestChileanalercemehccr250.jpg
Trees: Giant carbon storage creatures.

OO Scientists Seeking To Save World Find Best Technology Is Trees for sucking CO2 out of the atmosphere and storing it.

OO Communities Create Timber Company To Protect Sumatran Forest - planting, instead of logging trees, in and around villages.

2015-02-16-tongkonanhousesulawesiwikipediaccr264.jpg
The dramatic Tongkonan houses in Sulawesi, Indonesia, are built from forest materials. Wikipedia

OO Sulawesi Communities Build Big, Unique Houses
By Sustainably Managing Forests

OO Indonesia: Despite Green Promise, Forestry Giant Destroys Forests, Peatlands - the culprit is Asia Pacific Resources International Ltd (APRIL).

@@ Video: Innovative Tourism Helps Protect Forests In Amazonian Peru

OO Indonesia: Community Managed Forests Have 11 Times Lower Deforestation Rate - than land outside their borders, says a new study.

OO Scientists Warn Investors On Cacao Company's Forest Destruction In Peru

OO Norway Asked To Divest From Forest-Destroying Company linked to a corrupt Malaysian official, who accrued wealth through destructive exploitation of Borneo forests in Sarawak.

2015-02-16-birdsofparadise8ofthe39spviaCornellLabofOrnithology.jpg
Papuan forests on the island of Papua New Guinea are home to Birds of Paradise that are found no where else in the world; when the forests disappear, so do the birds. Cornell Lab of Ornithology

OO Rapid Development Threatening Traditional Farms, Forests In West Papua - a system of community protected areas and family agricultural rotation that have maintained their way of life and forests' health for time immemorial is now threatened by government-fostered development.

OO The Amazon's Oil Boom: Concessions Cover A Chile-Sized Bloc Of Rainforest - that will be threatened by large scale destruction by a potent combo of greedy governments and companies, if the previous history of fossil fuel and resource exploitation in rainforests there are any guide.

OO World Bank's Forest Carbon Program Falls Short on indigenous peoples' rights, says a new report, ready to fund projects without adequate safeguards for ensuring the community rights are respected.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this crocus I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Rising Seas, Family Planning Pays, and More!

(0) Comments | Posted February 9, 2015 | 1:46 PM

Today, the Earth got a little hotter and a little more crowded.

@@ Climate Change: The Elevator Pitch

*
*
*

2015-02-09-seaslugscaliforniaCreditGaryMcDonaldcourtestyofUCSantaCruzccr263.jpg
These sea slugs are now invading northern California. Gary McDonald, Courtesy of UC Santa Cruz

OO Pink Sea Slug Masses Migrate To North California As warming waters make it more hospitable to the Dr Seussian invaders.

OO Melting Ice, Warmer Temperatures Linked To
Massive Oxygen Loss In The World's Oceans
10,000-17,000 years ago, and this new research could explain what is currently happening in our oceans today.

Related Headline:

2015-02-09-coralreefNOAAlibraryatFlickrccr263.jpg
What a healthy reef looks like. NOAA library at Flickr

OO Something Really, Really Terrible Is About To Happen To Our Corals - many of them are on the verge of dying from a mass-scale bleaching event, as the ever warming oceans make it ever easier to create the conditions for one.

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

2015-02-09-fightingsealevelriseonHanIslandCarteretAtolloffPNG2.6.2015JeremySuttonHibbertInstagramccr263.png
Jeremy Sutton-Hibbert at Instagram Feb 6, 2015.
A Losing Battle: Locals rebuild a shoreline sea wall of giant clam shells, trying to halt erosion of their very low-lying land on Han Island, Carteret Atoll, off of Papua New Guinea.

Rising sea levels have eroded much coastline of the Carteret islands. Waves have crashed over the islands, destroying what little crop gardens islanders have. When this photo was taken food was scarce, with islanders living on a meager one meal per day diet of fish and coconut. Low-lying Pacific atolls such as this will suffer most from rising sea levels and changing weather patterns.

OO Everyday Climate Change, Now On Instagram

Related Headline:

OO The Making Of A Climate Refugee - As sea level rise sinks Kiribati, it could become the first Pacific nation to face mass exodus.

2014-07-06-populationmatters2green.png

Solving Climate Change and Hunger: Family Planning Pays says a new University of California at San Francisco report. "More than 800 million people on the planet are chronically hungry and climate change is accelerating," said lead author Joe Speidel, MD.

"Ongoing rapid population growth is making it much more difficult to address these serious world problems."

2015-02-09-CountdownposterfromLibraryFoundationofLosAngelesAlanWeisman.jpg
Just as too many people on a truck can make it difficult to get anywhere, too many people on the planet can make it difficult to solve the ensuing problems. Library Foundation of Los Angeles, Alan Weisman

Improving access to family planning could provide up to 29% of needed decreases in greenhouse gas emissions. Reducing the need to increase food production would help stabilize the climate, since crops and livestock production currently produce 30% of global carbon emissions. It would also make it easier to address world hunger.


OO Climate Change Mitigation's Best-Kept Secret:
It's Fairly Easy to Make Big Changes
- and to dramatically slow our methane emissions -- if we make the commitment to do so.

Related Headline:

OO It's Not Too Late To Stop Climate Change,
And It'll Be Super-Cheap
- especially compared to the cost and consequences of inaction.


2015-02-09-LyndonBJohnson500aCourtesyRogerRevellePapersUCSanDiegoccr263.jpg

OO A 50th Anniversary Few Remember:
LBJ's Warning On Carbon Dioxide

* * *

SOLAR KEEPS SAILING

2015-02-09-solarkeepssailingsydneyharbourwikipediaccr250.jpg
Wikipedia

OO Charting Hawaii's Spectacular Solar Growth

OO Latin America's Solar Market Grew 370% in 2014 - installed 600+MW, and will more than triple again in 2015. Ole!

OO Obama Backs India's $160 Billion Solar Push

2015-02-09-solarschoolatRodboroughsourceweyvalleysolar.co.ukccr243.gif

OO U.K. Solar Poised to Cruise Past 5 GW Milestone -650,000+ solar rooftop and ground systems have now been installed, and counting!

*
*
*

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO US Energy Department Provides $45 Million for Solar Manufacturing

OO US Company Gets $10 Million to Mass Produce Domestic Thin-Film Solar Cells to close in on making household solar power affordable.

2015-02-09-solarinafrica450creditFenixInternationalccr263.jpg

For customers in Uganda, the grid edge is the ability to charge a phone or keep an LED light powered.
Fenix International

OO Company Gets $12+ Million to Grow Solar, LEDs, Batteries and Businesses in Africa

OO Getting It Right: Europe Coulda Saved $100 Billion By
Installing Solar, Wind at Better Sites

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO An Upside Of Cheap Oil -- Countries Are Ditching Their Fossil-Fuel Subsidies

OO US Companies Snag Significant Energy Efficiency Venture Capital

OO Researchers Tout Solar Panels Made With 'Perovskite' Mineral - potentially making household electricity cheaper than ever before.

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO U.S. Wind Power Quadruples in 2014 As Texas Leads

OO The Shift Toward a Decentralized, Distributed Electric Grid Is Already Underway

2015-02-09-Nestthermostatyoutubeccr263.jpg

OO Nest Thermostat Pays for Itself in 2 Years - with a thermostat that learns, yielding new data about energy savings.


OO Hitting the Sweet Spot of Home Efficiency
For Big Savings

OO New Program Will Support Clean Energy And Efficiency For Low-Income Residents

2015-02-09-antifrackingphotoAPphotoMikeGrollccr257.jpg
AP photo, Mike Groll

OO Fracking Set To Be Banned From 40% Of England's Shale Areas

OO China 2014 Coal Output Seen Down 2.5 %, First Drop In A Decade

OO Germany Boosts Onshore Wind Capacity By Record Amount In 2014

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO Scientists Call On Obama To Stop Logging In Old Growth Forests

OO Groups Sue EPA Over Failure To Regulate Emissions From Factory Farms

OO At Vatican, EPA Chief To Talk 'Moral Issue' Of Climate Change

Informed Leadership:

2015-02-09-soilmoisture2satellitesolarpoweredSMAPartistsrenditioncreditNASAccr263.jpg
What the solar powered soil moisture satellite will look like in space. Credit NASA

OO As Global Warming Evolves, NASA Launches Soil Moisture Satellite

OO Pennsylvania's New Governor Will Ban Fracking In State Parks And Forests

* * *

2015-02-09-greenamericanflagwavinggreenccr263.png

OO Obama Budget Aims to Make Solar and Wind Incentives Permanent

OO Scotland Just Announced An Indefinite Ban On Fracking

Insights:

OO Accelerated Ice Melt Causing Iceland to Rise which could affect its volcanoes and hastening eruptions that disrupt air travel.

2015-02-09-supercellthunderstormoverGreatBendKSCreditLanePearmanatFlickrccr263.jpg
A supercell thunderstorm. Credit Lane Pearman at Flickr
Thunderstorms Help Bring Ozone Down to Earth, where it contributes to global warming, reports Brian Kahn at Climate Central, from its usual haunt high up in the atmosphere, where it acts as a UV shield. Research indicates that under continued climate change, storms could increase up to 40% by 2100 over the US, shifting planetary ozone function from shielding UV to accelerating global warming.

OO Climate Change USA: Snowier Winters, But Less Snowy Springs

OO Southern Forests' Ability To Suck Carbon From The Air May Be Slowing

2015-02-09-CaliforniaSierrasnowpackMammothmountainwww.kcet.orgccr263.jpg
Snowpack in the California Sierras. Source: www.kcet.org

OO Scientists See Shrinking California Snowpack As Harbinger - with future warming reducing California's natural water reservoir - its mountain snowpack - by more than half by 2100.

Good Ideas:

2015-02-09-solarkeepsrising467solarpvsunrisesourceGreenTechMediaccr243.png

OO Making a Marketplace For Renewable Energy:
Utilities as Matchmakers
- matching up communities and farms with excess solar power with businesses wanting to buy that power.

2015-02-09-naturalcapitalfreshwaterMaliauFallsinBorneoRhettButleratMongabayccr263.jpg
One global source of natural capital: fresh water. Rhett Butler at Mongabay.com

OO Accounting For Natural Capital On Financial Exchanges

OO Chinese Developers Get Active Building Passive Energy Homes

OO Save The World?
Less Beef And Travel, And Eat More Vegetables
- mom was right.

* * *

WHAT DOESN'T WORK

2015-02-09-CoalburnsinChinapeasantstovecreditSeanGallagherinstagram2.4.2015ccr263.png
Sean Gallagher at Instagram
Coals burns in a peasant's stove in China, which produces 46% -- and burns 49% of total global coal (US EIA). Greenpeace notes online that, "a third of all CO2 emissions come from burning coal. It's used to produce nearly 40 % of the world's power."

Fossil Fuel Follies

OO Drought-Stricken California Let Oil Companies
Inject Waste Into Drinkable Water Sources

OO Millions Of Gallons Of Oil Settled
On Gulf Sea Floor After BP Oil Spill
and continue to wreck the ecosystems there.

OO Pennsylvania: Fracking Companies Regularly Commit Serious Environmental Violations

2015-02-09-tarsandsAlbertaoilgoesintopondfromAtlanticSep2014photoessayReutersToddKorolccr263.png
@@ How to Make a Moonscape on Earth: The Alberta Tar Sands - a photo essay. Todd Korol at Reuters

OO W Virginia: Pipeline Explodes With Huge Fireball making this the 4th major mishap at a US pipeline in a month.

2015-02-09-pipeline450alaskawikimediacommons.jpg Wikimedia Commons

OO The Pipeline Fight Does Not Stop With Keystone XL - other pipelines equally or more dangerous are in the works.

OO Oklahoma: Nearly Daily Earthquakes Connected to Fracking
Shaking Up Communities


2015-02-09-extremeweatheracompositeUSAmeharte.png

The damage costs of US extreme weather will continue to escalate under climate change.

The Cost of Climate Change:

OO Earth's Dashboard Is Flashing Red--Are Enough People Listening?

OO Obama Orders Rising Seas Built In to Building Standards

Falling Short on Leadership:

2015-02-09-biomassharvestingofUSforestscctw86.png
This is what's happening to American forests, so Europe can burn them up as wood pellets.

OO Obama's Climate Plan Threatens US Forests - Regulating emissions and clean energy? Yes. Promoting the burning of our forests for biofuels - and saying it's "carbon-free"? No!

OO Evangelical Senator James Inhofe Says Only God Can Cause Climate Change
OMG! You mean God burns fossil fuels? God help us if Inhofe's in charge of the US Senate Environment committee.

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-09-anomaltempfeb092015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 8, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures; although an atmospheric river dumps rain in California, warmer temperatures prevent much of that water to be stored as snow in coastal mountains, and so the drought continues.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-02-09-majorblizzardnortheastUSJan282015CreditNOAAccr263.jpg
A major blizzard covered the northeast US recently with snow; such extreme blizzards are predicted to worsen in intensity and frequency under continuing climate change. NOAA

@@ Picture This: So Much Snow

OO Global Warming Could Make Blizzards Worse

2015-02-09-USmapdividedbywarmingseasonsclimatecentralccr263.png
Don't bother clicking -- go here to play with this. Fastest warming seasons by state: only in Texas is summer warming the fastest. NOAA

The US Is Divided by Seasons and Warming reports Brian Kahn at Climate Central, but every season has been warming since 1970 throughout the US, and the rate of warming has accelerated. In summer, the Lower 48 has warmed by 0.4°F per decade, while the winter has warmed slightly faster: about 0.6°F per decade.

2015-02-09-Australiaheatsup50020130711.png

Climate Change Will Hit Australia the Hardest reports Oliver Milman at the UK Guardian, possibly on track for a rise of more than 5°C (10oF) by 2100, outstripping the warming rate in the rest of the world, says the most comprehensive analysis ever produced of the country's future climate.

OO Climate Change In Minnesota: More Heat, More Big Storms


Social repercussions:

OO Climate Stresses Push Kashmir's Poor Into Militancy,
Pakistan Experts Warn

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon


2015-02-09-birdsofparadise8ofthe39spviaCornellLabofOrnithology.jpg
Papua New Guinea is home to many species of Birds of Paradise that are found no where else: as those forests disappear, so do they. via Cornell Lab of Ornithology

OO Deforestation May Be Accelerating In Papua New Guinea

OO Indonesia: Sumatran Community Takes Charge To Protect Its Forest


OO After 10 Years Vying For Protection,
Kalimantan Community Granted Legal Rights To Its Forest
- communities are key in protecting forests.

2015-02-09-tigersiberianRhettButleratMongabayccr263.jpg
Wild Siberian Tigers are now only found in part of Russia and a northeast province in China.

OO China Tries Out Logging Ban In Northeastern Province

OO 155 Chinese Nationals Arrested For Illegal Logging In Myanmar

OO Radical Transparency: Tracking Deforestation Through Satellite Imagery

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this Chilean protea I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-02-09-DSCN6244.jpg This is even more colorful when brilliant orange Chilean bumble bees visit the...
Read Post

Climate Change This Week: The Midwest Threat, Green Money Flows, and More!

(0) Comments | Posted February 2, 2015 | 2:09 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-02-02-globalwarming570comicsnonsequitor2jan312015ccr262.png
Gocomics.com

"whether an event is caused by climate change
... is the wrong question.
All weather events are affected by climate change
because the environment...

Read Post

Climate Change This Week: State of the Climate, Solar Rise, and More!

(0) Comments | Posted January 26, 2015 | 2:07 PM

Today, the Earth got a little hotter, and a little more crowded.


OO A "Cheesy Love Story" : The Fun Ad Doritos Doesn't Want You to See - palm oil is bad for people and our carbon-storing rainforests. It's in Doritos.

Related Headline:

OO Fake Doritos Ad Pressures Pepsi Over Palm Oil Policy

* * *

The State of the Climate

Takeaways:

* Our global "water insurance," glaciers, are melting away.

* Sea level rise: 8 inches over past century -- now, rising much faster.


"The Fuse is Blown":
Glaciologist's Jaw Dropping Account of a Shattering Moment

Eric Rignot co-authored a paper last spring showing that large areas of the West Antarctic Ice sheet are now in "irreversible decline" -- think irreversible sea level rise....

* Things are changing FASTER than the science predicted.

But we can act to address this fast - the solutions are relatively cheap!
Will you be part of the solution?

2015-01-26-oddsthathottestrecordedyearssince2000arenotrandomwarmingvariationccr261.png
Just how likely is global warming man-made, not random variability?

OO Go Figure: Figuring the Odds of Earth's Hot Streak of Years - by statisticians on the warming being random, rather than man-made.

OO EPA Plans Oil and Gas Methane Emissions Cuts - up to 45% by 2025 (from 2012 levels) Well, that will hack away at a future source ... but what about present sources from fossil fuel operations - and from the tundra due to global warming?

SOLAR KEEPS RISING

2015-01-26-solarkeepsrising500solarsunrise.jpg

OO Solar Power On The Rise - As the cost of solar power continues to fall, the market booms worldwide: in many parts, it is now cheaper to produce solar power than fossil fuel or nuclear energy

2015-01-26-solarpvconstructionworldwideccr261.png

OO USA: Solar Is Cheaper Than the Grid
in 42 of the 50 Largest Cities
- and in almost all of them, solar is a better investment than the stock market.

Related headline:

OO Report: Forget Stocks, Invest In Solar Panels

2015-01-26-solarjobs620xsourcewww.popularresistance.orgccr261.jpg

OO Solar Is Adding Jobs 20 Times Faster Than the Broader Economy


Related Headline:

OO The Solar Industry Created More Jobs In 2014 Than Oil And Gas Extraction

2015-01-26-rooftopsolar310_200SourceGreenTechMediaccr261.png

OO US South Goes Solar:
Bipartisans Support Solar Spread in Florida & Georgia
- from tea partyers to liberals.

2015-01-26-Solarhomesale310xresaleSourceGreenTechMediaccr261.jpg

OO Host-Owned Rooftop Solar Improves a Home's Resale Value - says a new study.

OO CA: Another Big 550MW Solar Farm, Desert Sunlight, Goes Online - as California adds solar capacity in half-gigawatt chunks.


OO US SunEdison Plans $4B Solar Factory, 5GW of Projects - In India

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2015-01-26-uselessenergycutasthmaccr261.png


OO Save Energy --> Cut Pollution --> Cut Children's Asthma - is the message that really works to get people to cut home energy use, says a UCLA study.

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO US Produces More Wind Power Than Any Other Nation President Obama said in his 2015 State of the Union address, notes the Power of Wind team at the American Wind Energy Association. We also make the most productive wind turbines, but all that is threatened by the recent cut of the federal Production Tax Credit in Congress.


OO Americans Getting More Serious About Global Warming As A Priority - says a new Pew Poll, but at 22nd place in the list of 23 top policy priorities, you might wonder how - 38% of those polled put it on the list, however, and that's a popup of almost 10% from last year.

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Maine: Green-Energy Inspiration Found on a Danish Island - Maine's Monhegan stands to learn from the Danish energy-independent island of Samso.

OO California Takes Lead In Developing Energy Storage - mandating enough stored energy in its utilities to power 1 million homes.

OO US Automakers Keep Rolling Out Electric Vehicles


2015-01-26-ChinatrafficBeijingWikipediaccr261.jpg
The many, many reasons why China is cutting subsides for polluting non-electric cars. Wikipedia

OO China to Cut Subsidies for Non-Electric Vehicles

OO Soon 80% Of Canada Could Have A Carbon Price


OO Mines Worldwide Becoming Important Market for Renewables - both as providing solar/wind power sites on deserted lands, and powering current operations with clean renewables.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO Poland's Shale Gas Revolution Evaporates In Face Of Protests


OO W VA: Facing Backlash, Board Of Education Votes
For an Accurate Climate Change Curriculum

2015-01-26-pipelineprotestmar22014.jpg


OO Activists Rally Across USA: Call On White House To Reject Keystone XL


OO Religious Activists Tell Republicans To Get Religion On Climate Change

Insights:

2015-01-26-peatswampinMalaysianBorneomongabayccr235_resize.jpg
Mongabay

OO Drying And Burning Peatlands Amplify Global Warming

Good Ideas:

OO Biggest Energy Innovation? Go Without - energy efficiency is the invisible fuel.

OO Making Bike Sharing Part Of Public

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies:

OO New - And Worrisome - Contaminants Emerge
From Oil And Gas Wells
- two new hazardous fracking waste chemicals - ammonium and iodide - are pouring into Pennsylvania and West Virginia waterways, a new study shows.

OO Who Needs Lobbyists?
Big Energy Spends Big Ad Bucks To Win American Minds

OO Fracking Plays Dirty - fracking sand companies in Wisconsin are asking to be annexed to cities so country regulations don't stop their growth.

2015-01-26-rateatwhichtheworldburnsoilccr261.png

OO Burning Oil : 2.7 Million Gallons A Minute and Rising - Global oil consumption has never been higher and is rising.

OO Canada: 230,000 People With No Drinking Water After Diesel Spill


2015-01-26-biomasspollutionccr261.jpg
Biomass burning emits greenhouse gases, and is how America is legally burning its carbon-storing forests: turning them into wood pellets and exporting them to European fireplaces.

OO EPA Gives Green Light to Biomass Pollution - a bad idea, made worse when people start defining carbon-storing forests as "biomass." Burning biomass emits greenhouse gases.

Even more emissions occur when OO Biomass Industry Plays With Fire and gets burned.

Related Headline:

OO UK: 'Green' Biomass Boilers May Waste Billions In Public Money

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png
Even elephants can't survive on oil. Credit: Mary Ellen Harte

OO House Passes Sneaky Bill
Attacking Public Health and Environmental Regulations


*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-26-anomaltempjan252015.png

Daily Climate Change: Global Map of Unusual Temperatures, Jan 25, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

2014-07-06-populationmatters2green.png

Nature's Breaking Points: Humanity Has Crossed 4 Out Of 9 'Planetary Boundaries' says a new study, reports Joel Achenbach at the Washington Post, beyond which we are destabilizing our environment and creating an unsafe future for humans in coming decades. The crossed boundaries are the extinction rate, deforestation, atmospheric CO2 levels, and the flow of nitrogen and phosphorous into the oceans.

Although the paper mentions our exploding populations, the authors miss that for what it is: the most obvious crossed boundary of all, and the main force pushing us beyond other boundaries.

2015-01-26-additionaldeathsannuallyfromglobalwarmingsaysWHOccr261.png
An array of human ills, from allergies to depression will increase in a warming world and cause additional deaths, says the World Health Organization.

OO Seven Ways Climate Change Could Really Kill You include allergies, heart attacks, salmonella outbreaks, depression, malaria, diarrhea, heat exposure and malnutrition, all of which will increase as the world warms further, the World Health Organization warns.

Natural Repercussions:

OO Global Warming Linked To More Extreme Weather And Weaker Jet Stream - more directly than ever.

2015-01-26-StatueOfLibertyWavesourceCitizenOfEarthatDailyKos.jpg
Source Citizen Of Earth at DailyKos

Sea Levels Rising Much Faster Than Previously Thought says a new study, reports Seth Borenstein at the Sacramento Bee via AP. The study uses a new method showing that the rise during much of the 20th century was actually underestimated by about 30% -- that is, the rise was slower.

But that means the rise since 1990 to present must be actually far faster to account for current levels. So, the current rise is much faster than previously estimated. Oh-oh.

Related Headline:

OO Sea Level Rise Accelerating Faster Than Thought

OO Earth's Fresh-Water Resources At Risk says a new study.

2015-01-26-hialtitudesouthwestconiferforestinGrandCanyonNPCreditParkWilliamsLamontDohertyEarthObservatoryccr261.jpg
High altitude forest in the Grand Canyon National Park. Credit Park Williams, Lamont Doherty Earth Observatory

Dry Skies Literally Drying Out And Threatening US Southwest Forests reports John Upton at Climate Central, say researchers. Due to drought, the skies are holding so much less water than they could that it is creating a lack of vapor pressure, known as a vapor pressure deficit.

This ends up pulling moisture out of the high altitude southwest forests atop plateaus and mountains. This, added to decreased snowpacks and higher temperatures, is behind ever worsening wildfire seasons there, and increasing loss of forests.

OO Alarm Over Siberian Sea Permafrost Thaw, Methane Leak where a Russian gas company plans to drill - just west of the peninsula where a giant sinkhole was discovered last summer, probably created from methane escaping the melting permafrost.


2015-01-26-fishdieoffsourcewww.dcclothesline.comccr261.jpg
Source: www.dcclothesline.com

OO Mass Die-Offs Of Fish, Birds, Mammals Increasing - some of which are consistent with climate change.

OO 2014 Was The Warmest Year Ever Recorded On Earth

OO Perennial Arctic Sea Ice Continues To Shrink - threatening the planetary summer thermal shield.


Human Repercussions:

2015-01-26-droughtsignprayforrainsourcefacebookccr253.jpg
Source Facebook

OO CA: Drought Fears: Signs Of 4th Straight Dry Year - state and federal water officials sound the alarm, saying that more action will be needed to combat the continuing drought.

OO Los Angeles Basin: Far Higher GHG Methane Emissions Found

OO Fishing Industry Could Lose Up To $41 Billion Due To Climate Change says a new study.

2015-01-26-trematodeparasiticSchistosomawormWikipediaccr261.jpg
A parasitic trematode worm, magnified. Wikipedia

OO Another Reason To Fear Climate Change: You May Get Worms - parasitic ones, like the ones that invade your skin in the tropics.

OO Asia: Climate Change Plagues Nepal In The Himalayan Mountains as melting glaciers deprive it of needed hydroelectric power and change weather, threatening food crops.

OO Pakistan: Climate Change Turning Mountain Communities Into Soup of Hazards - as hotter temperatures that melt glaciers, and heavier rains create far more flooding.

2013-12-08-smog659pxBeijing_Forbidden_City_SmogacreditBrianJeffreyBeggerlyviawikimedia_resize.jpg
Smog over the Forbidden City in Beijing, China. Credit Brian Jeffrey Beggerly via wikimedia commons.

OO Airpocalypse Now: Beijing's Toxic Smog Soars Off Charts. Again.

OO Africa: Global Warming Foments Extremism in Boko Haram - contributing to the ongoing violence.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-26-deforestationinMalaysiaareahitbyespbadfloodingatMongabay.comccr261.jpg
Logging is widespread in Peninsula Malaysia, and in Malaysian Sarawak on Borneo Island.

OO High Deforestation Rates In Malaysian States Hit By Flooding

OO Sarawak Malaysia May Stop New Logging
After Much Deforestation And Corruption

2015-01-26-amazondevastationfromgoldmining500w.jpg

OO Amazon Gold Rush Destroying Huge Swaths Of Rainforest

OO Deforestation Climbing - Along With Fears - In The Amazon

2015-01-26-steakdinnerWikipediaccr261.jpg
The real price of that steak dinner? More climate change, and threats to your health. Try something deliciously green next time! Wikipedia.

OO Global Warming Driver: Rising Meat Consumption
Pushes Farming Past Deforestation
- says a new study.

OO Sulawesi Village Seeks Protection For Sacred Forest
Threatened By Development - it supplies their water and, yes, store lots of carbon.

OO Palm Oil Expansion May Play Role In The Ebola Crisis - as expansion into forests increases likelihood of transmission from wildlife to humans.

Good Conservation Ideas:

2015-01-26-treeclimbingCourtesyTimKovarinPortlandTribuneccr261.jpg
Courtesy Tim Kovar in the Portland Tribune

OO Tree Climbing As A Tool To Build Respect For Forests


OO Sulawesi, Indonesia: Farmers Help Restore Degraded Forests

OO Community Forest Management Attracts International Attention
In Sulawesi, Indonesia

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this stinging plant flower I photographed in Chile. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change: 2014 Hottest Yet, Oceans Threatened, Solar Trees, and More!

(4) Comments | Posted January 19, 2015 | 3:23 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-19-averageglobaltemperaturestimelineatthenytimesccr260.png

OO 2014 Breaks World Heat Record - both NOAA and NASA, federal US science agencies, agree it is the hottest year our planet has experienced since 1880, when records...

Read Post

Climate Change This Week: The Heat Is On, A Wind Power Tree, and More!

(0) Comments | Posted January 12, 2015 | 12:34 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-12-annualglobaltemperatureaverageaJapanMeteorologicalAgencyclimatecentralccr259.png
Japan Meteorological Agency is the first of 4 major global temperature recordkeepers to release their data for 2014, notes Brian Kahn at Climate Central.

OO 2014...

Read Post

Climate Change This Week: Foul Fracking Fumes, Solar Sponge, and More!

(0) Comments | Posted January 5, 2015 | 12:41 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Why the US China Climate Deal Is Real - because their rapid development of fossil fuels, particularly coal, has put them on a collision course with some very, very, hard physical limits - like water.

OO China Plans More Closures Of Coal Mines Through 2016 - closing 2,000+ this year, and limiting itself to 10,000 by 2016.

2015-01-05-FrackingnrschoolplaygroundcredBrookeAndersonatfractracker.orgccr253.jpg
Fracking wells occur all over, such as near schools -- or near you.
Credit: Brooke Anderson at fractracker.org

OO Fracking Fumes: Hazardous to Your Health - Emissions from oil-and-gas production threaten human health significantly. Immediate steps are needed to reduce exposure to the toxic pollution, says a new analysis of studies by by the Natural Resources Defense Council.

2015-01-05-bread2wikipediaccr257.jpg
Wikipedia

OO The Bread Threat:
Warming Will Reduce Wheat Production
, research shows.

2015-01-05-Pope_Francis_2013wikipedia.jpg Wikipedia

OO Pope Francis to Issue Climate Edict


SOLAR KEEPS RISING

2015-01-05-solarkeepsrising467solarpvsunrisesourceGreenTechMediaccr243.png

OO How I Chose to Pair My Solar System With an Electric Car

OO Net-Zero Communities Using Solar Power
Expand In Florida

OO Japan to Build World's Biggest Floating Solar Farm

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO 2014: 4 Key Developments in Distributing Clean Energy

* Germany's Top Utility Chucks Coal, Concentrates on Clean Energy

** Solar Power With Storage Becomes Competitive for a CA Utility

*** New York Plans a Large Scale System of Clean Energy Microgrids

**** Hawaii Demands a Solar, Wind Power Future With Energy Efficiency


OO Employment Drops All Over the Power Sector--Except in Renewables!


OO 2014 Saw Key Developments in Storing Clean Energy - with California making big strides, Tesla's Giga battery factory, and the breakout of new batteries.

The Best Things That Happened To Renewable Energy In 2014 reports Katie Valentine at Climate Progress include:

2015-01-05-solarroadsolarroadinNetherlandsccr257.png
The 230 foot long bicycles-only road will produce enough solar power for 3 homes. From acorns grow...
Solarroad

> World's First Solar Road In The Netherlands

<> Solar Power Efficiency Broke The 40% Barrier!

><> World's Largest Solar Plant Comes Online

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

> Scotland Was Totally Powered By Wind For A Month!

<> World's Largest Tidal Array Gets Green Light

><> World's Largest, Most Powerful Wind Turbine Comes Online

2015-01-05-Sunswiftsolarcarwent500kmupto85mphrecordccr257.jpg
Australia: university students built Sunswift, a solar car that went 500 km on a charge, with an average 87 mph speed - fast and far. Now, they're working on making it legal for regular roads. Sunswift

> Solar Car Hits Speed Record, Could Soon Hit The Streets

> Researchers Continue To Develop New Ways To Use Solar - from solar cloth to a solar sponge that can, researchers claim, convert 85% of solar energy into steam.

<><><><>

OO Washington State: Offers Ambitious Cap-and-Trade Plan - one of the most sophisticated and all-encompassing climate-pollution pricing programs.

OO Vermont Closes Nuclear Power Plant to Invest in Renewables

2015-01-05-commutingbybicyclewikipediaccr257.jpg
Already a fixture in some European cities, commuting by bicycle programs are starting to take off in the US. Wikipedia

OO Bicycle Commuting Programs Start Lowering US Emissions
and Enriching US Cities


OO Australia Records Biggest Emissions Drop in Decade
Due to Carbon Tax
- the bad news is that the new Prime Minister axed the tax. BOOOOO!

WHAT WORKS

Speaking Out:

2015-01-05-antifrackingphotoAPphotoMikeGrollccr257.jpg AP Photo/Mike Groll

OO New Yorkers Strongly Approve Of State's New Ban On Fracking

2015-01-05-sheldonwhitehouse50thviaclimateprogress.jpg
OO The Climate Action Senator:
Sen. Sheldon Whitehouse Pushes for Change In 83 speeches
- doing what no man has done before....


Informed Leadership:

OO Obama's Secret Love For Science

Good Ideas:

OO Regional Cap N Trade State Groups:
the Congress-free Climate Solution

*
*
*

WHAT DOESN'T WORK

Fossil Fuel Follies :

2015-01-05-fossilfuelmoney.jpg

OO Fossil Fuel Industry Spent $700+ Million During 2014 Elections - 10 times more than environmental groups.


OO Disused Oil And Gas Wells A Major Source Of Methane

2015-01-05-childrencleanupBangladeshoilspillinwetlandsanctuaryccr257.jpg
AP Photo

OO Barehanded Children Help Clean Up Massive Bangladeshi Oil Spill - in the world's largest mangrove forest, a protected sanctuary for a rare dolphin, as experts arrived to help.

OO World's Top 500 Firms' Greenhouse Gas Emissions Rise 3% from 2010 to 2013, far off the cuts urged by the United Nations to limit global warming, says a new study.

2015-01-05-DeepwaterHorizon_fire_20100421wikipedia.jpg
The massive oil spilled by Deepwater Horizon is replicated every two months on average in Russia. Wikipedia

OO A Deepwater Horizon Every 2 Months:
Constant Oil Spills Devastate Russia

2014-07-06-populationmatters2green.png

*
*

2015-01-05-pigfacegovernmentofAustraliaccr258.jpg
Source: Government of Australia

OO The Population-Pork-Climate Change Connection:
China's Massive Pork Appetite Raises Emissions
- via greenhouse gas emissions from its massive farms, and from the deforestation to plant soybeans, a pig feed. The bad news? Pork consumption is ever rising in China

*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-05-anomaltempjan042014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Jan 4, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the eastern US and the waters surrounding it, are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, continuing its long drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

OO Earth Could Lose Its Summer Thermal Shield by 2020 (yeah, in 5 years) say experts; an ice-free summer Arctic Ocean would significantly add to global heating, as dark waters absorb the heat from 24-hour sunlight that ice once reflected.

2015-01-05-coralreefscene1DanNortonMicronesia.jpg
Credit: Dan Norton

OO 'Doomed' Corals To Face Worst Bleaching In Decades - as a trade wind cycle winds down in the next few years, accelerating warming and ocean acidification. A recent UN report estimated that warming ocean climes, ocean acidification, and the resulting bleaching events will cost the world economy over a trillion dollars in various resources and services by 2100.

Social Repercussions:

OO UK: Almost 7,000 Properties To Be Sacrificed To Rising Seas over the next century with no compensation to owners, as it becomes too costly to protect them.

2015-01-05-mosquito01tigermosquitocreditJamesGathany_resize.jpg As climate warms, the mosquitoes that carry dengue fever spread ever farther afield. Credit James Gathany

OO Dengue Fever Could Spread to Europe say UN researchers, and expand in South America and Africa due to climate change and urbanization.

OO Malaysia: "Unusually Strong" Rain Causes Worst Flooding in Decades;
100,000+ Flee

OO Irreversible But Not Unstoppable:
The Ghost Of Climate Change Yet To Come


2015-01-05-floodinginPakistanSeptember2014K.M.ChaudaryAssociatedPressccr257.jpg
K. M. Chaudary/Associated Press

OO The Extreme Weather And Climate Events Of 2014 In 13 Photos meteorologically speaking, 2014 saw record heat, record snow, record flooding, record drought, rising sea levels and super typhoons -- and extreme climate events are expected to continue unless humans take action to reduce emissions.

2015-01-05-TwintornadoesJune162014Nebraskamashableattwitterccr257.jpg
These deadly twins devastated parts of Nebraska in June 2014. See the video here.
Mashable at twitter

OO U.S. Could See Damage Of $1.1 Trillion Through 2100
From Sea Level Rise, Storm Surge

OO Land-Based Ice Is Melting Faster Than Thought
-- Raising Sea Levels Faster, Too
- as in Greenland and Antarctic glaciers.

2015-01-05-shrimpplatterviawikipediawikimediacommons_resize.jpg
Research indicates that the wonderful flavor of shrimp decreases as the water in which they grow becomes more acidic. Wikipedia

OO The Taste of Climate Change Coming Soon: Yucky Shrimp - say researchers, who raised the bad tasting shrimp in acidified waters, like those that are expected to occur in the near future; the seafood economy is likely to suffer.

OO Acidic Oceans Threaten World's Mussels - and seafood palates.

California Dryin':

2015-01-05-roadkillbearfishermansdaughteratflickrccr256.png
Wildlife is getting killed as they cross roads more in search of scarce food in California. fishermansdaughter at flickr

OO California's Drought Is Threatening Its Wildlife as animals flee their homes and risk their lives in search of food.

OO Once Desert Springs Are Now Dry As California's drought continues.

2015-01-05-almondmarzipancandycrowbotatWikimediaCommonsviaFlickrccr257.jpg
Marzipan Memories Fading? Almonds are a key ingredient in marzipan. Crowbot at Wikimedia Commons

OO Water Source For Almonds In California May Run Dry - drying up the $11 billion boost to the state economy.

OO Lost California Rangeland Poses Greenhouse Gas Risk - as destruction from human activities replaces these carbon storage systems with ones that emit greenhouse gases

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-05-rainforestbirdscarlet_macaw_04RButler_resize.jpg
A beautiful inhabitant of Brazilian forests, the scarlet macaw. Rhett Butler/Mongabay.com

OO Brazil's Forests Threatened By 'Chainsaw Queen'
-- the New Agriculture Minister

OO Restored Forests Help Efforts Against Climate Change - conserving and expanding the world's immense tropical forests is the single most promising near-term strategy.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed at the De Hoop reserve in South Africa recently. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: No Forests -- No Farming, Divine Divestment, and More!

(1) Comments | Posted December 29, 2014 | 6:51 PM

Today, the Earth got a little hotter, and a little more crowded.

*
*

2014-12-29-ClimatechangexmascarolersbyNishantChoksiattheNewYorker12.22.2014ccr257.jpg

Climate-Change Christmas Carols - by Ethan Kuperberg in "Shouts and Murmurs" at the New Yorker caught my eye. Okay, I admit I haven't sung any...

Read Post

Climate Change This Week: Bishops Bugle, Latin Solar Salsa, the Price of Heat, and More!

(0) Comments | Posted December 23, 2014 | 11:59 AM

Today, the Earth got a little hotter, and a little more crowded.


@@ The 2014 IPCC Synthesis Report Video - informative, engaging...

OO Study: Hotter Days In US Mean Less Cold Cash - Days that averaged about 77 degrees ended up reducing people's income by about $5 a day when compared with days that were about 20 degrees cooler.

2014-12-23-droughtsignprayforrainsourcefacebookccr253.jpg

OO American Drought: California's Economic Crisis - recent storms are not going to end the 'worst drought in a generation' that is turning much of central California into a dust bowl, and bringing one of the richest states in America to its knees.

2014-12-23-popefrancisandbishopsAPphotoAlessandraTarantinoccr256.jpg
"We express an answer to what is considered God's appeal to take action on the urgent and damaging situation of global climate warming." Alessandra Tarantino/AP Photo

OO Catholic Bishops From Every Continent Call
For 'An End To The Fossil Fuel Era'

* * *

SOLAR KEEPS FLYING, RISING, SAILING, SMILING, SURFING,

2014-12-23-solarkeepssurfing2windsurfingatColvabeachsourcebeachesingoacomapr2012.jpg

OO Texas: Austin Aims for 950MW of Solar Along With Bold Distributed Energy Goals

OO First Solar Plans to Expand US Solar to All
with Community Solar Projects
- and has acquired a solar community project company to do so.

OO Distributed Generation Like Solar Will Double Globally By 2023 says a new report.

2014-12-23-sunwithsombrero.png

Latin America's Breakthrough Solar Year, reports Adam James at GreenTechMedia, is characterized by the fastest growing solar PV market in history. Chile dominates the solar boom, and has the largest merchant solar plant in the world. But the US Company SunEdison is scoring on the action as the major developer behind the boom... way to go, SunEd!

OO Australia Reaches 4GW Of Rooftop Solar PV

OO Solar Rises In Malaysia During Trade Wars Over Solar Panels

2014-01-31-geostellargetcleanenergy.png
* * *

GOOD CLEAN NEWS

2014-12-23-Copenhagen_at_nightRoei.tabakatWikimediaCommonsccr256.jpg
Copenhagen at night. Roei.tabak at Wikimedia Commons

OO Copenhagen Lighting The Way To Greener, More Efficient Cities - a growing wireless network of streetlamps and sensors is saving money, cutting the use of fossil fuels and easing mobility, part of its ambitious goal of becoming the world's first carbon-neutral capital by 2025.

OO Paying For A Healthier Planet - using green bonds to encourage Mexicans to save energy.

OO West Coast States Lead Electric Vehicle Adoption In U.S.

2014-12-23-Chinagreatgreenwallwww.care2.comccr256.jpg
OO Great Wall Of Trees Keeps China's Deserts At Bay a new study says of the massive belt of trees being planted across China's arid north.

OO China Is In A Genuine Retreat From Coal,
Says Ex Energy Secretary Steven Chu

OO Many Govts Now Embrace Zero Carbon Emissions By 2050 - in a historic first.


2014-12-23-goplogohalfgreenelephant220_resize.png

OO Poll: Half Of Republican Voters Back Limits On Carbon - something for the GOP Congress to remember in 2015.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:


OO Top Scientists To Media:
Stop Using 'Skeptic' To Describe Climate Science Deniers

OO 'We're Running Out Of Time':
Leading Climate Scientist Unveils Latest Numbers On Climate Change


OO Seattle Billionaire Steps Into Coal Fight - to fund a suit against the Dept of Interior on leasing public land for coal. He's Seattle Seahawks owner Paul Allen.

2014-12-23-localsprotestsouthernoregonpipelineMailTribuneJamieLuschccr256.png
Mail Tribune/Jamie Lusch

OO Oregon: Most Residents Speak Against Proposed Southern Gas Pipeline

OO 11 SenatorsTold EPA How To Make Its Carbon Rule
Cut Even More Power Plant Emissions

2014-12-23-ObamaonStephenColbertReportDec82014ccr256.png

OO Colbert Report: Obama Downplays Keystone Benefits, Highlights Drawbacks


OO Climate Change Should Be A Human Rights Issue announced the International Bar Associatio, able to be challenged in a court of law.

2014-12-23-endangeredgoldenrumpedshrewinEAfricaKenyacoastforestccr256.jpg
The endangered golden rumped shrew inhabits an endangered habitat, an east African coastal forest.

OO Greens Protest, And Company Backs Away
From Kenya's Rare Coastal Forest

OO Groups Call On World Leaders To Stop Incentives For Big Dams which often destroy communities, important habitat, and emit the potent greenhouse gas methane.


Insights:

2014-12-23-choicebetweenactionnoactionviaIPCCviaClimateprogressccr256.jpg
Humanity's choice (via IPCC): Aggressive climate action ASAP (left figure) minimizes future warming. Continued inaction (right figure) results in catastrophic levels of warming, 9 °F over much of U.S.

OO What We Learned About Climate Change In 2014, In 6 Charts - here are two of them, above and below; remember, often climate models underestimate the real effects... and the costs.

2014-12-23-droughtacrossplanetby20812100viaClimateProgressccr256.jpg
Palmer Drought Severity Index (PDSI) for 2080-2099 with business-as-usual warming. By comparison, during the 1930s Dust Bowl, the PDSI in the Great Plains rarely exceeded -3 (see here). Source: Cook et al. and Climate Progress.

* *

2014-12-23-globalweirdinginteractiveishereglobalweirding.ishereccr256.png
The beginning of the global weirding interactive - hint, hint: the spinning ball gets redder as time rolls on...

OO Here's What Will Happen This Century
If We Don't Do Anything About Climate Change
Via cool graphics and animation, Global Weirding helps summarize how the planet may change over the rest of the century, using the most reputable source of information, the latest IPCC report.

OO Greenland's Ice Sheet Shifts Could Speed Melt - the sheet's dynamics are changing, which could ultimately raise sea levels that much faster.


2014-12-23-methaneleakfromoceanflooruseastcoastccr256.jpg

OO Warming Ocean May Be Triggering Mega Methane Leaks Off Northwest Coast as methane that was trapped in crystalline form beneath the seabed melts and is being released. -- and fast.

See also:

OO 'Widespread Methane Leakage' From Ocean Floor Off US Coast

2014-07-06-populationmatters2green.png

OO Mainstream Media - Newsweek - Tackles Overpopulation:
222 Million Women Need Access to Contraceptives
- not just physical access with accurate information about their use and results, but cultural encouragement and freedom.

2014-12-23-orchidcollage550MEHccr245.png
Many orchids are now endangered or going extinct, as we destroy their special habitats.

As it is, our exploding populations are changing the climate and irreversibly extinguishing much of the beautiful tapestry of life on Earth, and our mega life support systems, our ecosystems.

* * *

WHAT DOESN'T WORK

The Legacy of Fossil Fuels, and Their Combustion:

"We have privatized profits and socialized costs"

Fossil Fuel Follies

2014-12-23-santaflyingthrupollutionccr256.png
Santa to Planet Earth: All You'll Get For Christmas Is More Coal - And Global Heat

OO Coal Demand Set To Break 9 Billion Tonne Barrier This Decade

OO Sloppy Fracking Practices Result In Large Methane Leaks

OO Florida Fracking: State Uilities Want You To Pay For It


<><><><>

OO Methane Still Belches From US's Old Oil And Gas Wells


OO As U.S. Cleans Up, It's Exporting More Pollution

2014-12-23-teslaelectricroadsterwwindturbineswikipedia.jpg
A Tesla electric roadster: it can be a lot dirtier than it looks, depending on how the electricity was generated. Wikipedia

OO Without Clean Electricity E-Cars Aren't Clean says a new study; electricity from coal makes them worse than regular gas cars.

OO The U.S. Energy Story: Not a Pretty Picture
A new interactive map of US energy production over the past 20 years shows the biggest growth has been in natural gas, nuclear and biofuels; 2 out of 3 spout carbon emissions....

Ignorance:

OO Most Americans Aren't Aware Of The Health Impacts Of Climate Change

Bad Ideas: Damning Big Dams

OO False Victories For Sustainability: Amazonian Hydropower - there is a rising backlash against the huge economical, environmental, and sociological costs dams bring.

OO Lao Hydro Dam To Seriously Affect Vietnam's Mekong Delta both agricultural and aquatic resources, experts warn.


Delaying Action:

OO Climate Accord Struck In Lima, But Key Decisions Postponed

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2014-12-23-anomaltempdec222014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Dec 22, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, where the drought continues.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions

2014-12-23-PerupotatoesimperiledbyclimatechangeMilagrosSalazarIPSccr256.jpg
Peruvian potatoes are imperiled by climate change. Milagros Salazar IPS

OO Climate Change Creates New Geography of Food

OO UN: Drought In Central America Has Pushed 2.5m People Into Food Insecurity

OO Climate Change In Nicaragua Pushes Farmers Into Uncertain World

2014-12-23-endangeredanimals4www.kidsdiscover.comccr256.jpg

OO Earth Faces Sixth 'Great Extinction' As a growing human population and climate change eats away vital habitats.

OO Peru's Melting Glaciers A Deadly Threat As Temperatures Rise - with up to 40% of ice lost, water is filling existing lakes to the brim and spawning hundreds of new ones.

OO Developing Countries Need A Lot More Investment To Adapt To Climate Change

2014-12-23-BeachwithpeoplesurfersSydneyAustraliaWikipediaCommonsccr256.jpg
Endless Summer Ending? The world's beaches are disappearing from human development and climate change. Wikipedia.

OO World's Beaches Being Washed Away Due To Coastal Development increasing, and ever higher sea walls to defend against fierce winter storms and rising sea levels, say two of the worlds' leading marine geologists.

OO Rising Sea Levels Could Make Florida Residents 'Climate Refugees'

OO Waters Warm, And Cod Catch Ebbs In Maine

2014-12-23-prawnsoupwculturedshrimpinVietnamThyKhueLyflickrccr256.jpeg
A special regional soup in Vietnam features the area's cultured prawns. Thy Khue Ly at Flickr

OO Under Current Practices and Climate Change, Aquaculture Boom Is Unsustainable

OO Australia: National Agency Warns Of '$1 Trillion' Natural Disasters Exposure

Nature's Repercussions:

2014-12-23-supertyphoonusaginearsPhilippinesNOAAccr256.jpg
Note that the size of super typhoon Usagi is as large as the Philippines. NOAA

OO Warm Ocean Waters Boosting Typhoons, Record Heat

OO Reindeer Populations Declining Due To Climate Change, study finds.

California Dryin':

2014-12-23-roadkillbearfishermansdaughteratflickrccr256.png
A casuality of the road. fishermansdaughter at Flickr

OO California Animal Deaths Spike On Sierra Roads As Drought Hits Habitat sending bears and deer especially loping across roads and highways this fall, apparently searching for scarce food.

OO California's Drought Probably Wasn't Caused By Climate Change - But Worsened By It indicates new research by the National Oceanic and Atmospheric Administration.

<><><><>

OO Storm Pounds CA, But To The Drought, Just A Spritz

OO California Needs 11 Trillion Gallons of Water to Recover from Drought - ummm, that's 11,000,000,000,000 gallons.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2014-12-23-AmazonrainforestRhettButlerccr256.jpg
Amazon rainforest canopy. Rhett Butler at Mongabay

OO Growth Of Forests May Not Be Keeping Pace With Rising CO2 Levels

OO Forest Conservation Tied To The Rights Of Indigenous Communities

OO Indigenous Communities 'Among The Very Few Best Protectors' Of Peruvian Amazon

2014-12-23-indigenousforestcommunityinPeruAchuarwww.pachamama.orgccr256.png
An indigenous forest community in Peru, the Achuar. www.pachamama.org

OO Deforestation Puts Cultural Survival Of Forest-Dependent Peoples At Risk

OO Indonesia: Huge Borneo Forest Swath To Be Destroyed By 'Sustainable' Company

2014-12-23-bambooinMadagascarRhettButleratMongabayccr256.jpg
Rhett Butler at Mongabay.com

OO Bamboo Could Help Fight Global Warming as a fast growing forest species that can store carbon and repopulate degraded forest, and be harvested for commercial use.

OO An App To Save 400 Million Animals which are essential to the health of the forests that nurture them. The app helps track poachers, traffickers.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Happy Holidays, Folks!

2014-12-23-DSCN1560a_resize.jpg...
Read Post