iOS app Android app

Mary Ellen Harte
GET UPDATES FROM Mary Ellen Harte
Mary Ellen (Mel) Harte Ph.D. is a biologist who writes on climate change and population issues. She co-authored the free downloadable book, Cool the Earth, Save the Economy, at Cool the Earth, and produces the weekday "Climate Change Report," 90-second audio newscasts, as well as the Climate Change Reports blog.

Entries by Mary Ellen Harte

Climate Change This Week: US Kabooming, Solar Winning, and More!

(4) Comments | Posted March 2, 2015 | 4:42 PM

Today, the Earth got a little hotter, and a litte more crowded.

@@ Climate Change, The Elevator Pitch: Climatologist Simon Donner

@@ How To Combat Climate Denial: the Online Course where you can see the above video and many more interviews at the new Skeptical Science Massive Online Course (MOOC) on climate denial; you can sign up here.


2015-03-02-ArmitageOnTheNatureofThingsCreditJulietaCervantesccr266.jpg

A new dance production on climate change by Karole Armitage will premiere in New York City, March 25th at the American Museum of Natural History.

@@ ON THE NATURE OF THINGS March 25-27, 2015, 8:00pm $25-35
The American Museum of Natural History, The Milstein Hall of Ocean Life
Tony nominated choreographer Karole Armitage will premiere a new site-specific dance production about climate change and its cultural context, created specifically for the Museum's Milstein Hall of Ocean Life. Check it out!

OO Dear Alaska: We Have Your Air. Please Come Pick it Up. And Bring us Back Ours. Love, Eastern US.
2015-03-02-depression466fromdisastersMaxBoschiniatflickrccr240.jpg Credit Max Boschini at flickr

A Perfect Storm of Population and Climate Change: Water Rationing and Riots have begun in cities, especially in developing countries like Pakistan, reports Michael Specter in the New Yorker. Climate change has disrupted increasingly the natural global distribution of water into floods and droughts, as human populations have increased exponentially. So will social disruption, unless we confront both imbalances soon, and fast.

2015-03-02-palmtreesundercutbyrisingtidesfunnelogychannelatinstagrameverydayclimatechangefeb272015ccr266.png
Credit funnelogy at instagram

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

Palm Trees Imperiled by rising water levels on Siargao Island, Philippines, where they are no longer supported by the soil that they grew from, now washed away by the tide.

The coastline is being carved deeper and deeper by powerful waves as palm trees tumble down, one by one.

The island is doing its best to adapt by protecting its wealth of mangrove swamp forests.

*
*
*

SOLAR KEEPS FLYING

2014-12-30-Solarkeepsflying500SolarplanethesolarimpulsecourtesyofSolarImpulse.jpg

OO Getting Everyone Involved:
Major US Solar Companies Announce Workforce Initiative
- to diversify the force both in gender and economic backgrounds.

OO Solar Energy's New Best Friend Is ... The Christian Coalition - as Christians note their mandate of preserving God's creation and their children's future.

OO Buyers Will Pay More For Homes With Solar Panels says a new study.

2015-03-02-Solarhomesale310xresaleSourceGreenTechMediaccr261.jpg Source GreenTechMedia

OO How Do You Know Your Solar Panels Are Working Correctly?
You Probably Don't
- many homes have malfunctioning or even non-functioning systems, a study found, despite meters that tell owners how the system is performing.

OO San Diego, CA Utility to Expand Solar-Power Microgrid
With a $5 Million State Grant

OO San Antonio, TX: Offer Free Electricity For Using Rooftops as Solar Power Sources - is the tack for a pilot utility program to spread solar rooftops into lower income communities.

2015-03-02-indiasolar620villageviaclimateparliamentatclimateparlnet.jpg
Source climateparl.net

OO Decentralized Renewables Set for 70% Annual Growth in India says a new report.

OO India Starts Building World's Largest Solar Plant, Overtaking U.S. - the 750 MW project could ultimately power some 2 million households.

OO Bangladesh Aims to Be the World's First Solar Nation via rooftop solar mainly, says the government, with financial assistance from the World Bank and others.

2015-03-02-TanzaniasolarhomeTimMcDonnelltheClimateDeskatMotherJonesccr266.jpg
This man uses his solar panels (visible on the roof behind him) to power up villagers' cellphones. He charges them for 12 cents apiece. Credit: Tim McDonnell/the Climate Desk

OO These Tanzanian Villages Don't Have Plumbing -
They Have Solar Power

OO One Million Solar Homes - Tanzanian Style - means designing, building and installing solar panels, lighting, batteries and a meter in an off-the-grid home, which is then paid in installments as cheap as twenty cents a day. It's a model that might light up Africa.


2014-01-31-geostellargetcleanenergy.png

Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO Deutsche Bank Seeks to Buy $1 Billion in Green Bonds

OO Citigroup Sets $100 Billion Funding Goal for Green Projects

OO Influential Financiers, From Warren Buffett To Bill Gates,
Are Divesting Fossil Fuels


2015-03-02-UniversityofColoradoSourceUniversityofColoradoccr266.jpg
A campaign to get universities to stop investing in greenhouse gas-producing fuels has come to the University of Colorado requesting it divest from coal and petroleum companies. Source: University of Colorado

OO Fossil Fuel Divestment Effort Comes To Colorado - as activists ask the university to divest.

OO Michele Bachmann Inspired Factcheck.Org
To Debunk Lies About Science
- finally, Michelle inspires truth, even if she has no idea what it is.

OO Oil Price Drop Won't Derail Climate Push, Says White House

2015-03-02-applecarconceptSourceosxdaily.comccr266.jpg
Source, osxdaily.com

OO Apple Gears Up to Challenge Tesla in Electric Cars

OO Utilities Expand Into Charging Stations For Electric Cars

<<< Big Bad Batteries!! >>>

OO Vanadium Flow Battery Aims to Compete With Lithium and Lead-Acid at Grid Scale

OO Advances in Lithium-Sulfur Batteries Offer Promise for Electric Cars

2015-03-02-windoffshorefarmbalticviathehuffingtonpostdec2013cctw90.jpg
Huffington Post

OO U.K. Approves World's Largest Offshore Wind Farm

* * *

WHAT WORKS

Speaking Out:

OO Harvard Prepares To Fight Fossil Fuel Divestment Case In Court - as students represent themselves and future generations of Harvard students in the fight for a decent future.

OO BP: Huge Rise In Energy Demand At Odds With Climate Change Fight - but is BP really going to do anything about it? Ha!


OO Catholics Around The World Will Fast For Climate Action During Lent

2015-03-02-BillNyeonBillMaherclimateskepticsaredeniersccr266.png
Bill Nye on the Bill Maher show. screencapture

@@ Video: Bill Nye: Let's Be Honest, Climate 'Skeptics' Are Just Deniers

OO World's Biggest PR Firm Calls It Quits With American Oil Lobby - despite a multi-million dollar relationship.

2015-03-02-vegetablemarketsectionSourceTheDailyClimateccr266.jpg
Source: the Daily Climate

OO Americans Should Consider Eating Less Meat
For Environmental Reasons, Scientists Say

OO Scientists, Policy Experts: Time to Phase Out Carbon Emissions Entirely


OO State Lawmakers Push Electric-Car Ownership With Bevy Of Bills


2015-03-02-futuresouthwestmegadroughtscenescollageccr265.png
Future US landscapes?

OO NASA Study Warns Of Unprecedented North American Drought

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies:

OO Huge Explosion Rips Through California Oil Refinery,
Adding Fuel To Oil Worker Strike

2015-03-02-solarvsfossilfuelsoil2ccr266.png
Which Fire Do YOU Prefer? A serious accident - fire, explosion, toxic release - happens almost weekly in a US oil refinery. Electricity from solar power could power cars and heat homes instead.

"Take a gallon of gasoline. Close it up. Put it on a hot barbecue grill. Multiply that by a million. That's a refinery."

Oil Refinery Safety Expert Kim Nibarger testifying before Congress, 2013


YOU CAN ACT : Oil workers are 6 times more likely to die on the job than the average American. http://inthesetimes.com/working/entry/17623/oil_strike Demand safe working conditions at oil refineries now.

Then resolve to personally divest from oil: get rooftop solar panels and an electric heater, for starters.


The BP ad spoof that tells it like it is ... enjoy!

OO Fed Predicts Up To 10 Derailments A Year Of Fuel-Hauling Trains

OO California: Health Concerns Mount After Refinery Explosion
Coats City With White Ash

Exposure to amorphous silica, which Exxon said the dust was composed of, is associated with an increased risk for inflammation, granuloma formation and emphysema..


2015-03-02-fireballfromderailmentoftraincarryingoilinWVAfeb2015sourceDailyClimateccr266.jpg
Source Daily Climate

OO West Virginia In State Of Emergency After Massive Oil Train Explosion

Related Headlines:

OO West Virginia Oil Train Derailment Sends Crude Tanker Into River

OO Train Carrying 3 Million Gallons of Crude Still Burning

OO After W Va Explosion, Oil Trains Rerouted Through Virginia Towns

2015-03-02-oildisastersCreditAndrewBreinerimagesfromAPShutterstockCTVccr266.jpg
Credit Andrew Breiner, images from AP, Shutterstock, CTV

OO Four Oil-Related Spills Reported In North Dakota -
Latest In A Week Of Oil Mishaps

OO Bill Gates Still Ignores Climate Change --
It Will Undo His Foundation's Work

2015-03-02-coalashdumpsinNCarolinaownedbyDukeEnergySourceTheDailyClimateccr266.jpg
Source: The Daily Climate

OO US Charges Duke Energy With Illegal Pollution From 5 Coal Ash Dumps

OO India's Air Pollution Is Cutting 3 Years Off Residents' Lives -more than half of the country's population live in regions with high levels of air pollution, a new study has found.

Misleading the Public:

*
*

2015-03-02-WeiHockSoonclimateskepticscientisthidtiestofossilfuelsponsorsSourceTheDailyClimateccr266.jpg
Wei-Hock "Willie" Soon, a scientist who promoted climate change as neither important nor manmade, listed his work as "deliverables" when billing fossil fuel companies that paid him to write climate doubting papers, discovered documents show. He often violated ethical publishing guidelines by failing to disclose his ties to these companies. Source: The Daily Climate

OO Contrarian Scientist Is Accused Of Taking Corporate Cash For Science - Willie Soon: "no amount of money can influence what I say or do or research or write." If recently released documents are accurate, he is a liar.

Related Headlines:

OO Deeper Ties To Corporate Cash For A Doubtful Climate Scientist


OO Documents Reveal Fossil Fuel Fingerprints On Contrarian Climate Research

2014-07-06-populationmatters2green.png

OO Taps Start To Run Dry In Brazil's Largest City - São Paulo water crisis is linked to growth, leaky distribution, climate change, and deforestation, and now officials contemplate evacuation.

OO As China Gets Richer, The World Gets Dirtier,
Via the Momentum of Over One Billion People
- not surprising, especially as much of its one billion people rise above poverty and start consuming like the rest of the developed world, via rapid industrialization, the same process that has made it a major contributor of greenhouse gases.

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2015-03-02-anomaltempmar022015.png

Daily Climate Change: Global Map of Unusual Temperatures, Mar 2, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US lower 48 are colder than normal, although the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot has drifted south and north of the California coast, but little rain is reaching the state, sending it into further drought.

Much of the areas surrounding the North Pole, including Alaska, are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

And The Heat Goes On...

OO USA, January & February 2015:
Vastly More Daily Warm Records Than Cold Ones

OO Hottest 12 Months On Record Globally Thanks To Warm January,
Reports NASA

2015-03-02-winter2015snowfallSourceClimateCentralccr266.jpg
US 2015 winter snowfall to date vs the average.

OO Dry or Snowy? Extreme Winter Weather Splits Much of U.S.


OO Sea Ice Still Declining, Despite Antarctica's Gains

2015-03-02-sealionsinCASourcetheDailyClimateccr266.jpg
Source, the Daily Climate

OO California Sea Lion Deaths: Warmer Seas May Be To Blame which can affect vital things like food sources.

2015-03-02-lemurstoprowwikipediaccr266.jpg
Many of Madagascar's lemurs are endangered from deforestation; now climate change threatens them further. Wikipedia

OO Climate Change Threatening Madagascar's Endangered Unique Lemurs - already declining from rampant deforestation and poaching, the lemurs will be further devastated by climate change.

.
Social Repercussions:

2015-03-02-oceanacidityeffectssocialandmarineNRDCviaccentralccr266.png


Climate Change Threat to US Seafood and Fishing Economies Is Rising as ocean acidity rises, reports Brian Kahn at Climate Central, and a new study analyzes how this will affect US coastal economies.

OO California Water Becomes Scarce and Energy Hungry - as the continuing drought forces much more energy to be used to pump water from groundwater rather than surface water supplies, such as rivers.

OO Climate Change To Make Infectious Disease Outbreaks More Frequent

2015-03-02-corncropinEuropecreditH.RaabatFlickrccr252.jpg
Credit H. Raab at Flickr

OO Climate Change Hampering World Food Production - profound societal changes will be needed in coming decades to feed the world's growing population, researchers at an annual science conference said. Like changing family size, humanely?


2015-03-02-sealevelrise490gifsourceclimatecentralccr240.jpg
Source: Climate Central

OO Rising Sea Levels And Temperatures Ahead For NY City

OO Global Warming Could Make
NYC Super-Rich Jealous Of Row House Residents
- as reports project what would happen if city buildings lost power in extreme heat and cold.


OO SF, CA: King Tides At Candlestick Point Offer Glimpse Of Planet's Future - As recent king tides washed over a small beach there, San Francisco Bay became a classroom for teaching the grim reality of sea-level rise.

OO Early Start To US West Wildfire Season - over the last forty years, the fire season has more than doubled across the West, now spanning 7 months or more.

2015-03-02-floodingsunderbansBangladeshSourceaidindia.orgccr266.jpg

Source AidIndia.org

OO Millions At Risk From Rapid Sea Rise In Swampy Sundarbans - seas are rising more than twice as fast as the global average in this low-lying Bengal Bay delta of 200 islands, where some 13 million impoverished people live.


2015-03-02-sardinesMeditstaplemigratingtowarmerwatersaTheDailyClimateccr266.jpg
Climate Deniers Fail To Convince Sardines, Which Vote With Their Fins - the Mediterranean food staple is swimming north to cooler waters. Source: The Daily Climate

OO Sardines Swim North To Keep Cool - and escape warming seas, leaving Mediterranean fishermen with empty nets.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

OO Indonesia To Squander Fuel Savings On Biofuel Subsidies
That May Drive Deforestation
, say environmental groups.

YOU CAN ACT


2015-03-02-orangutanIndonesiandeforestationforbiofuelsphotomontageSOBIARIndonesiaRANccr266.jpg
You cut down my home for fuel? Tell the Indonesian president here to stop this gift to the deforesting palm oil industry.

Threats:

OO New Guinea Rainforest Being Leveled For Palm Oil - revealing gaps in zero deforestation pacts.

2015-03-02-chimpsendangeredEastAfricaCreditRhettButlerccr266.JPG
Many endangered chimpanzees in East Africa live in habitat threatened by oil palm expansion. Photo by Rhett A. Butler.

OO Scientists Sound The Alarm On African Palm Oil Investment

OO Chinese Banks Funding Rainforest Destruction In Indonesia

2015-03-02-ParaguayindigenousAyoreohomeabandonedfrombulldozerccr266.jpg
Paraguay: A traditional communal Ayoreo house that was abandoned because of bulldozing activity. Photo courtesy of Survival International.

OO Paraguay: Indigenous Communities Threatened By Deforestation,
Despite Having Land Rights

Solutions:

OO Campaign Asks Consumers To Directly Support Forest Conservation

2015-03-02-forestfrogsbiodiversityCreditGuiBeckeratmongabayccr266.jpg Maintaining healthy biodiversity could reduce the threat of disease from wild habitats worldwide, a new study indicates. Credit Gui Becker at mongabay

OO Biodiversity May Reduce The Threat Of Disease

OO Indonesian Forestry And Fishery Ministries Move To Eradicate Corruption

2015-03-02-GuyanaforestCreditTiffanyRoufsccr266.jpg
Credit Tiffany Roufs at Mongabay

OO Local Technicians Effective At Forest Monitoring study finds.

Insights:

OO Brazil: Land Threatened By Dam Projects Belongs To Indigenous Munduruku Tribe - confirms the independent foundation, Funai.

2015-03-02-MundurukuindigenousnativePeruCreditMarcioIsenseeeSatmongabayccr266.jpg
Brazil: A Munduruku indigenous native. Credit Marcio Isensee e Sá at mongabay

OO Dams Or Indigenous Land: The Battle Over The Munduruku Frontier -The Munduruku indigenous tribe are marking their land boundaries , in an action that could halt Brazil's giant São Luiz do Tapajós hydroelectric dam,, which would flood this sacred land. 'We are not leaving,' says the village chief.

OO Selective Logging Causes Long-Term Changes To Forest Structure


There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by thesegentian I photographed one summer. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-03-02-DSCN0236Gentiandancing.jpg...
Read Post

Climate Change This Week: Apple Goes Solar, Apocalyptic US Droughts Predicted, and More!

(7) Comments | Posted February 23, 2015 | 3:45 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Deadpan Climate Humor At Its Best:
Philomena Cunk Moments of Wonder - Climate Change
- of course, one can easily imagine some US voters really believing that coal comes from dinosaurs - and that burning it has made dinosaurs rare... Philomena played by the talented comedienne, Diane Morgan.

*
*

2015-02-23-futuresouthwestmegadroughtscenescollageccr265.png
Likely future scenes of the US Southwest and Great Plains, as scientists predict the worst megadroughts in the past 1000 years to unfold from 2050 onwards, as a result of global warming.

US Southwest, Great Plains Could Soon Face Worst 'Megadroughts' In Modern History, study finds, reports Ari Phillips at Climate Progress. The NASA/NSF funded study builds upon recent research, predicting megadrought conditions, starting by 2050, that will far surpass even the worst southwest medieval megadroughts thought to have caused the downfall of ancient Native American civilizations, such as the Pueblos.

The extreme results surprised even the study researchers.

2015-02-23-tolesdroughtcartooncolorTomTolesattheWashingtonPostccr265.jpg
Tom Toles at the Washington Post

Related Headlines:

OO Droughts Will Hammer US West As 21st Century Unfolds

OO U.S. Central Plains, Southwest Likely Face Apocalyptic Drought

OO Southwest, Central Plains Face 'Unprecedented' Drought

*
*

2015-02-23-BostonsnowcoverscarsFeb2015CreditStevenSenneAPphotoccr265.jpg
Boston, February 2015: I know my car's around here...somewhere... Credit Steven Senne, AP photo

OO As Boston's Crazy Snow Keeps Falling,
Scientists Weigh In On Climate Impact

"All weather events are affected by climate change because the environment in which they occur is warmer and moister than it used to be." --Kevin Trenberth, IPCC climate scientist

Related Headlines:

2015-02-23-Arcticaneurismexplainedmehccr265.png

OO Cold Air Invasion Coming: What's the Role of Warming?

OO Weird Winter Weather Plot Thickens As Arctic Swiftly Warms

OO Global Warming May Be Affecting Jet Stream - A winter of strange weather and turbulent transatlantic flights in the northern hemisphere has scientists asking: Has a predicted climate imbalance of the jet stream begun?

@@ The Climate Change Elevator Pitch: Ken Caldeira

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

2015-02-23-climaterefugeeofSomalidroughtCreditMatildeGattoniatinstagramccr265.png

February 21, 2015: Sarura Aden walked for 25 days across the Somali desert to a crowded, unsanitary and undernourished refugee camp in Kenya, witnessing the killing of other refugees by militia and wild animals, as she fled a tremendous drought that had destroyed all of her livestock and her way of life. Credit Matilde Gattoni at Instagram

2015-02-23-pollutingpowerplantinFloridaWalteratFlickrccr265.jpg Credit Walter at Flickr

Paris Climate Pact To Rely on Peer Pressure, Cooperation, Not Coercion reports John Upton at Climate Central. Having failed at forcing countries to achieve needed carbon cuts within specific time frames, the UN will now focus on a process that includes national accountability instead. Will it succeed? Stay tuned.

More Warming Woes for Corals:

2015-02-23-crownofthornsstarfishWikipediaccr265.jpg
Crown of Thorns starfish are big suckers and can devastate coral reefs. Wikipedia

OO Great Barrier Reef: Warmer Waters Helping Coral-Eating Starfish Thrive

OO Warmer Oceans Helping Coral-Eating Starfish Thrive

2015-02-23-FutureArcticbyEdwardStruzikbookccr265.jpg

OO Arctic Upheaval: new book outlines challenges at the top of the world

*
*
*

SOLAR KEEPS FLYING

2014-12-30-Solarkeepsflying500SolarplanethesolarimpulsecourtesyofSolarImpulse.jpg

OO The Carolinas Have Become Hot Spots for Solar Market Expansion

OO Duke Energy Proposes $69M Investment in South Carolina Solar

OO Massachusetts: the Second-Biggest Employer for Solar Power

2015-02-23-applesolarsun.png

OO Apple Plans $850Million Solar Plant With First Solar
To Power All California Operations

Related Headline:

OO Apple Deal, Tax Change Could Spark Corporate Solar Stampede of contracts driven by the looming change in a solar tax incentive that makes such projects particularly attractive.


OO The Great Solar Panel Debate: To Lease or To Buy? read who did which, and why.

2015-02-23-DesertSunlightfarmCreditUSATodayScreenshotccr265.jpg
Credit USA Today, Screenshot

OO One Of The World's Largest Solar Energy Farms Opens In California

Related Headline:

OO Solar Farm Capable Of Powering 160,000 Homes Opens In California


OO Minnesota: Regulators Approve Projects That Will Boost Solar Power There 10x


OO U.S. Companies Pledge To Build 20 GW Of Renewable Energy In India

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

OO Judge Halts Use Of Eminent Domain On Nebraskans For Keystone Pipeline


OO Fed Report: Gas Can Replace Coal Plants, Supporting Obama Climate Plans

2013-11-28-EnergyStarColorLogo.jpg


OO EU Energy Consumption Level Falls To 20-Year Low

OO "Stop Me Before I Kill the Planet":
Another Major Oil Producer Calls for Carbon Pricing

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO Google Buys Altamont Wind to Power Its Headquarters,
Surpassing 1 GW in Contracts

OO Germany Leads Record Wind Power Growth in Europe

2015-02-23-climatelibeljusticeSourceShutterstockatClimateProgressccr265.jpg
Source Shutterstock

OO Climate Scientist Wins $50,000 In Libel Lawsuit
Against Conservative Newspaper
- as the judge notes that the paper can be skeptical about climate science without creating misleading or false statements about scientists.

OO Tesla Plans Battery for Household Energy-Storage Market

<><><>

OO Obama Looks to Raise $2 Billion in Climate Change Investments

OO US Factories Are Polluting Way Less As They Clean Up Their Acts as environmental rules emerge.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO New York Times: Those Who Deny Climate Science Are Not 'Skeptics'

2015-02-23-antigeoengineeringgraphicsourceclimateprogressccr265.jpg
Source: Climate Progress

OO US National Academy: Forget Geoengineering - Even The Term Is Misleading since " 'engineering' implied a level of control that is illusory." The two academy reports concluded "There is no substitute for dramatic reductions in the emissions of CO2."

OO President Obama Emphasizes Cold Hard Truth About Climate Change

OO Ranking The Best And Worst Companies In Terms Of Deforestation - assessment ranks more than 400 companies, banks, investor, and other powerbrokers by the extent and scope of their sourcing policies for six 'forest risk commodities': soy palm oil, beef, leather, timber, pulp and paper.

Related Headline:

OO Chinese Companies Named And Shamed On List Of Deforestation 'Power Brokers'

OO Greenpeace Targets Banco Santander for Financing a Controversial Logging Company

Important Insights:

OO Warmer Seas Linked To East Coast Hurricane Outbreaks

2015-02-23-Castillejabouquet500wBenBlonder.png
A subalpine wildflower meadow in the Colorado Rockies is the site of the first and longest running global warming field experiment in the world. Credit Ben Blonder

OO 23-Year Global Warming Field Experiment Now Finds
Global Warming Impacts Already Underway
Full disclosure: the lead researcher, John Harte, is my husband.

OO Why Climate Scientists Are Right About How Hot The Planet Is Going To Get - historical evidence in sediments now back them up, a new study shows.

OO Fossil Fuel Pollution Decreased Rainfall In Central America - by shifting a vital rainfall belt south, says a new study that examined a 450 year old record rainfall and temperature.

2015-02-23-personreadingnewspaperpublicunderstandingclimatesourceTheDailyPlanetccr265.jpg
Source: The Daily Climate

OO Human Brain, Media Not "Wired" For Climate Understanding say 2 leading Australian scientists, and reporting all sides of a story often results in public confusion rather than clarity... maybe it has something to do with presenting all sides as if they all have equal legitimacy.

Good Ideas:

OO Save Mangroves: They Save Coral Reefs and Coasts
From Climate Change
- say federal scientists, who focus on how these coastal swamps can save our declining reefs.

2015-02-23-smartwindowviaheatgelSourceWangetalIndustrialandEngineeringChemicalResearchjournal2014ccr265.jpg
Source Wang et al, Industrial and Engineering Chemical Research journal, 2014

'Smart' Windows Could Save Energy Tiny droplets of a heat sensitive gel sandwiched between glass panes turn cloudy when it's hot outside, filtering out some warming sunlight, an improvement over current electronic versions, reports Sid Perkins at Student Science.

OO Want to Save money on your energy bill? There's a game for that.

OO Getting More Restaurants To Go Carbon-Neutral - begins the minute the customer walks through the door.

Informed Leadership:

OO UK's Three Party Leaders Sign Joint Climate Pledge

OO California Lawmakers Introduce Major Package Of Bills To Tackle Climate Change

OO Leading in Cleaning Up Trucking:
A Young Green CEO of a Big Company
- in trucking, worth $100 million.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

2015-02-23-frackingrigspossiblyOklahomaCreditShutterstockccr265.jpg
Credit Shutterstock

OO Small Earthquakes Linked To Fracking Could Lead To Major Ones - says a government scientist.

OO Canada: Oil Train Derails, Spills Unknown Amount Of Crude Oil

2015-02-23-bottlenosedolphinSourceyoumeanbiodiversity.wordpress.comccr265.jpg

Source youmeanbiodiversity.wordpress.com

OO Unusual String Of Bottlenose Dolphin Deaths Linked To BP Oil Spill

Dangerously Dumb Ideas:

OO Climate Hacking, aka Geoengineering, Is Barking Mad

OO Biofuel Goals Could Require All the World's Crops - which is just how much of a nonstarter it is, made in the 2008 free, downloadable book, Cool the Earth, Save the Economy.

2015-02-23-DeepwaterHorizon500_fire_20100421wikipedia.jpg

OO Oil And Gas Companies Won't Have To Pay For Damage Caused To Louisiana's Coast,
Judge Rules
- the world is theirs to exploit and trash without blame... thanks, judge.

OO Elon Musk Is Right: Hydrogen Is 'An Incredibly Dumb' Car Fuel - requiring far more mass and volume of the car, not to mention far lower efficiency in energy conversion.

OO Scientists: No, We Can't Fight Climate Change By Burning Trees - because trees are the cheapest way to store carbon, and burning them adds to greenhouse gases... duh. Why did the EPA create a memo even hinting at such folly as burning trees for energy?

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png

OO GOP House Passes Keystone Pipeline Construction Bill
Despite Obama's Opposition

OO GOP Senators Debate Whether Climate Change Is Real
At EPA Carbon Rule Hearing
- despite the overwhelming evidence and the agreement of reputable scientists that climate change is real. Your tax dollars and votes at work, folks!

2014-07-06-populationmatters2green.png

OO Big Cities Head For Water Crisis As Populations Explode - and the resulting climate change creates ever worsening droughts.

OO Populations Clash With Forest Conservation Via Agriculture

OO Borneo: Populations Clash With Forest Conservation Via Hunting

2015-02-23-oceanplasticonturtleCreditprojectgreenbag.comccr265.jpg
Credit: projectgreenbag.com

OO How Did We Ruin The Oceans? 7 Billion People, That's How - the climate-changing and chemical pollution of the oceans and voracious appetites of exploding populations are fueling dramatic changes and extinctions of marine animals and ecosystems, warn scientists.

2015-02-23-globalpopulationspeakoutgraphic2ccr265.png

*** YOU CAN ACT ***

Global Population Speak Out 2015 - pledge to become a Population Speak Out activist, raising public awareness in a variety of ways, including your own.

OO Population Taboo -- Kiss It Adieu! Dave Gardner of Growthbusters.org gives a good 2010 summary of why we need to speak out.

@@ The Most IMPORTANT Video You'll Ever See, Part I - Human populations are growing exponentially... see what this means for human survival.

* * *
WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-23-anomaltempfeb222015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 22, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US is experiencing colder than normal temperatures, while surrounded by abnormally warm waters. The increased moisture from the warm waters combines with the cold to produce record breaking blizzards in the northeast. Meanwhile, the abnormally warm eastern Pacific continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole, and the North Pole itself are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions:

2015-02-23-apocalypsevolcaniceruptionbyFranciscoNegroniccr265.jpg
A nearby volcanic eruption is evocative of the apocalypse. Credit: Francisco Negroni

OO Extreme Climate Change Tops List of How Civilization Will Most Likely End in a report created by Oxford scientists based on research. The other 11 global risks include everything but the obvious: too many people, which fuels many of the named risks.

* * *


OO Pennsylvania Vs. Climate Change: Lyme Disease Becomes Epidemic

OO Climate Change Threatens Future Of Australian Outdoor Summer Sport

2015-02-23-liftoffatKennedySpaceCenterCreditJatkinsatWikimediaCommonsccr265.jpg
Credit Jatkins at Wikimedia Commons

OO Researchers: Rising Sea Levels Having Effects At Kennedy Space Center

Natural Repercussions:

OO South America: Changes In Lakes Warning Signs Of Climate Change on other parts of the world, say researchers.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-02-23-loggingtruckinCamaroonCreditAmcajaatWikimediaCommonsccr265.jpg
A Camaroon logging truck full of murdered giants. Credit Amcaja at Wikimedia Commons

OO Illegal Logging Still A Big Issue In Cameroon

OO Zimbabwe Forests Under Threat

2015-02-23-forestnewlyclearedforpalmoilfarminSabahCreditRhettButleratMongabayccr265.jpg
Malay forest newly cleared for palm oil farm. Credit Rhett Butler at Mongabay

OO Illegal Logging Contributed To Deadly Malaysian Floods - says government minister.

OO Malaysian Authorities Failing To Take Action Against Poachers - wildlife is integral to forest health.

2015-02-23-milleniumtreeNewCaledoniaSourcewww.boardinggate101.comccr265.jpg Source www.boardinggate101.com

OO New Caledonia, SW Pacific: Ancient Majestic Trees Die Off, Near Extinction - no one reason can be pinpointed, but climate change appears to be fueling a few possible factors, including infestation, feral disturbance, and hot dry weather. These Millenium trees only start reproducing when they become 500 years old.


2015-02-23-chocolateswikipediaccr262.jpg
Where Do Your Chocolate Come From? Wikipedia

OO 'Sustainable' Cacao Company Allegedly Continues Deforestation to Farm


There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these crocuses I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-02-23-crocusespurple06_resize.JPG...
Read Post

Climate Change This Week: Norway Divests, Siberia Melts, and More!

(12) Comments | Posted February 16, 2015 | 12:09 PM

Today, the Earth got a little hotter, and a little more crowded.

OO Climate Change Elevator Pitch: Eric Rignot
of NASA's Jet Propulsion Lab is one of the globe's most accomplished glacier experts.

2015-02-16-HalibutAtlanticCreditJoachimS.MulleratFlickrccr263.jpg
Atlantic Halibut, a commercial fish. Credit Joachim S. Muller at Flickr

OO Climate Change Triggers Threats To Marine Ecosystems
A two-way migration of fish species between the northern Pacific and Atlantic as oceans warm could have drastic ecological and commercial impacts, as dramatic as when the Isthmus of Panama was open, thousands of years ago, which also allowed a Pacific-Atlantic exchange.

OO Global Warming Means Heavier Rain, and Snow:
Case in Point, Boston
- much warmer than usual sea surface temperatures helped double the local air moisture - and it all came down on Boston and beyond, shattering snow records... ignore the first video, which gets water vapor formation all wrong...


A Good Example of a Bad Science Video: Alluringly Simple -- and Wrong
"Why Global Warming Causes Bigger Storms"

Yes, warmer waters means more water vapor and ultimately heavier storms -- but the video gets water vapor formation all wrong. When water surface molecules heat up enough to break loose from other water molecules, they go into the air as water vapor. Expanding space between warming air molecules is irrelevant. Minnesota Public Radio, get your science right!

Now, if they had melted blue ice cream on top of the popcorn....

*
2015-02-16-rainwatercollectioninYemendroughtFeb132015matildegattoniatinstagramccr264.png

Matilde Gattoni
@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

A woman collects rainwater as the man-made water crisis grows in Yemen. Heavily dependent on oil revenues, due to dry up by 2017, its exploding population will double by 2035, and is rapidly outstripping its poorly managed and now scarce water supply. Poverty, mortaility, and unemployment are high: no wonder the country is a political mess.

2015-02-16-clarissathesolarpanelcartoon2CourtesyoftheTreeccr264.png
Clarissa the Solar Panel, by cartoonist First Dog on the Moon. Courtesy of The Tree, treealerts.org

OO The 2 Trillion Dollar Question, asks Clarissa the Solar Panel, is: why do we vote for leaders who fritter away $2 Trillion on climate changing fuels, when we now know there's a better way that's far cheaper?

* *

2015-02-16-birthcontrolpillsatDailyClimatefeb42015ccr264.jpg
source: Daily Climate


OO The Perfect Medicine for Climate Change: Birth Control, Say Experts - giving more women who want access to birth control to limit their family size - in both rich and poor countries could be a hugely effective way to curb climate change.

OO China Outcompetes US in Clean Energy Investments in 2014

* * *

SOLAR KEEPS DANCING

2015-02-16-solarkeepsdancingonthebeachatflickrccr260.jpg
Flickr

OO Off-Grid Solar Firms Raised $42 Million in the First Month of 2015 - that's two-thirds of what was raised in all of 2014.

OO Using Outer Space Ultra-High Efficiency Solar Cells on Your Rooftop to make a concentrated PV rooftop system is the latest breakthrough for a group of researchers.

OO Viriginia: Dominion V Power Plans 400 MW of Solar - as solar costs continue to decline, large-scale projects are the most cost-effective way to deploy solar power, the utility finds.

2015-02-16-solarhousesinHawaiicroppedNRELccr244.jpg
NREL

OO This New PG&E Program Will Allow Customers to Go 100% Solar

Related Headline:

OO California: Utility To Allow Customers To Get All Their Electricity From Community Solar

OO Minnesota's Great Leap Into Solar Begins - as legislation leads to an explosion in solar development.

2015-02-16-applesolarsun.png


OO Apple Plans a Solar-Powered Command Center in Arizona

OO World Bank Intends to Lend $500 Million
to Power Grid for Solar Infrastructure

OO China's Hanergy to Build Solar-Powered Cars -the market potential is huge, says the firm.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Wind And Solar Energy Have Tripled Since 2008 - clean energy progress has been immense on a number of fronts, says a new report.

Related Headline:

OO An Illustrated Guide to the State of America's Clean Energy Sector

Some Takeaways:

- oil and coal consumption have declined slightly; renewables have increased slightly
- wind and solar dominate the increase in renewables
- clean energy investment has increased 500% since 2004
- electric vehicle sales increased 25% in 2014, but still are less than 1% of car sales


OO US Government Energy Consumption at the Lowest Level Since 1975

2015-02-16-chinesedragongreenccr234.jpg
China continues to green itself.

OO China To Create Carbon Market And Cap Emissions

OO Norway To Cut Climate Pollution By 40 % By 2030 - but will it stop producing fossil fuels?

Related headlines:

OO Norway Sovereign Fund Drops Coal, Tar Sands, Gold-Mining Companies

OO World's Largest Sovereign Wealth Fund Dumps 40 Coal Companies

OO EU Policy-Makers Seek To Make Electric Transport A 'Priority'

Informed Leadership

2015-02-16-antifrackingphotoAPphotoMikeGrollccr257.jpg
AP Photo/Mike Groll

OO Fracking Moratorium Sought In Maryland

OO France to Ax Coal Subsidies While EU Stalls

*
*
*

WHAT WORKS

Speaking Out:

OO 14 High-Profile CEOs Want To Rid The Global Economy Of Carbon Emissions By 2050
"New jobs, cleaner air, better health, lower poverty and greater energy security."

2015-02-16-largestUSantifrackingdemonstrationprotestsofar350.orgfeb72015ccr264.jpg
8,000 strong in largest anti fracking rally in Oakland, CA despite rain. Source: 350.org

OO Health Sector Should Divest From Fossil Fuels, Medical Groups Say - just as they did with tobacco decades ago.

OO Health Care Industry Has Moral Obligation To Divest From Fossil Fuels, report argues.

2015-02-16-lobsterdinnerDSCN0865Aug2013MEHartea.jpg
The fate of Maine's lobsters is on the table.

OO Maine Report Warns Of 'Urgent' Need To Address Ocean Acidification
which threatens its lobster industry.

OO EPA Justifies Presidential Veto of Keystone Pipeline: Low Oil Prices, High Climate Cost

Related Headlines:

OO EPA: Keystone XL to Emit 1 Billion Extra Tons of GreenHouse Gases

OO EPA Gives Obama New Reason To Reject Pipeline: Low Oil Prices


2015-02-16-solarpanelsobamacredsolarpanelspowernet500.jpg
Source: solarpanelspower.net

OO Obama's New Budget Puts Billions Toward Fighting Climate Change

"The most costly thing we can do
is to do nothing,"

EPA Acting Deputy Administrator Stan Meiburg said.

2015-02-16-olympicrainforesttemperateforestRhettButlerccr260.jpg
Deforestation continues worldwide, even as recent research indicates that trees are the cheapest way to store carbon. Credit Rhett Butler at Mongabay

OO Scientists, Conservationists Call For More Inclusive Efforts To Save Forests

OO Wales Says No To Fracking Until 'Proven Safe' - just like Scotland and Ireland said.

OO Australia: Greens Call forAll Coal Mines to Close in New South Wales

Good Ideas:

2015-02-16-bulbs300energyefficiencyviaplusmathsorg.jpg Source: plusmaths.org


OO Low Energy Prices Offer Opening For Subsidy Cuts and governments in the Middle East and much of the developing world are doing so.

OO Money Versus Morals:
Why Economic Rewards Trump Polite Messaging in Efficiency
- money wins out, at least in Japan, in coaxing home energy efficiency gains.

<><><>

OO Low CO2 Emissions Tax Possible If Clean Technology Is Also Implemented

OO Lawmakers Propose Laws To Push Electric Car Ownership

Insights:

2015-02-16-arcticwaswarminPliocenefossilrecordsccr264.jpg
The Arctic was warm during the Pliocene.

OO Ancient Climate Records
Back Current IPCC Predictions
- yes, Virginia, the future climate is going to be just as disastrous as IPCC scientists predict, judging from our fossil records.

OO How Termites Hold Back The Desert, Fighting Climate Change - with massive mounds that provide a moist refuge for plants in a dry landscape.

2015-02-16-tornadoinCampoCO31May2010MattClarkatflickrccr238.jpg
Credit Matt Clark at Flickr

OO Global Warming May Spawn More Southeast US Tornadoes

OO Rise In Wildfires May Resurrect Chernobyl's Radiation - Climate change may help spur fires there that could release radioactivity locked in soils, letting them spread all over Europe. allow them to spread over Europe.

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies

OO Coal Companies Don't Pay Enough To Mine For Coal
On Federal Land, Report Says


2015-02-16-coralreefviaDailyClimate264.jpg
Source: Daily Climate

OO Great Barrier Reef Dredging Is Causing Major Damage, Study Finds From dumping fossil fuel waste coming from coastal ports; the reef has already lost half its corals over the past 3 decades from pollution and environmental hazards.

OO New York Banned Fracking, But 460,000 Tons Of Fracking Waste Have Been Dumped There

Clueless Leadership:

OO Australia: Wind Farms Face $13 Billion Wipeout From Political Impasse - as investments flee.

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-16-anomaltempfeb152015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 15, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought, while unusually cold temperatures in the northeast combined with unusually warm coastal waters contribute to massive blizzards there.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-02-16-atmosphericriverbringsrain2toCAJan2015ccr264.png

Global Warming Helps Block Atmospheric Rivers
That Water California
Atmospheric rivers have been mostly diverted from reaching California by a persistent high pressure Pacific system off California of the type predicted to occur under climate change in a 2005 study.

Not enough is known to predict why the high pressure system occasionally allows an atmospheric river to sneak in and water California, though reports Andres Thompson at Climate Central. The latest river is far from significantly easing California drought.

OO Winter Is Losing Its Cool Nights in US Cities - climate change is decreasing the number of below-freezing nights in most cities, even as it helps produce massive blizzards.

2015-02-16-meltingpermafrostcratersSiberiaCREDITFLICKRSTEVEJURVETSONccr263.jpg
Planetary Freezer Unplugged: Melting permafrost craters in Siberia. Credit Steve Jurvetson at Flickr

OO Climate Change Is Accelerating The Melting Of Siberia - one of the planet's largest storehouses of frozen greenhouse gases. Oh-oh.

OO A Fresh Look At Oceans Shows Earth's 'Unabated Planetary Warming'

2015-02-16-hottestyearstop10climatecentralccr264.jpg


OO UN's World Meteorological Organization Chimes In:
2014 As Hottest Year
- a little over 1°F above the next hottest year.

OO 14 Of The 15 Hottest Years On Record Have Occurred Since 2000, WMO Says

2015-02-16-pikaatdailyclimatefeb32015ccr264.jpg
These are super cute little guys, that give off high little peeps when alarmed. Source: Daily Climate.

OO Disappearance Of Bunny-Like Pika Linked To Climate Change

Social Repercussions:

2015-02-16-historicfloodinginAlbaniafeb22015APphotoHektorPustinaccr264.jpg
AP photo/Hektor Pustina

OO PHOTOS: Albania In State Of Emergency After Historic Extreme Flooding - the second worst on record.

2015-02-16-NewYorkcitymapw100ftseariseJeffreyLinnccr264.jpg Recognize the Big Apple? Just oa third of all glaciers have to melt completely for this to come true - and almost all glaciers are melting now...

OO Maps Show What Major US Cities Would Look Like With Future Sea Rise - created by Jeffrey Linn, aided by a background in geography and urban planning, they assume 100 or more feet of sea rise: not projected to happen by 2100, but it's likely that future children will face this and other disastrous problems, depending on how fast we stop carbon emissions.

OO Rising Temperatures Threaten US Mountain States

Related Headline:

OO Colorado: Climate Change Could Bring More Disease, Crop Damage, Fires
State-commissioned study sees 2.5 to 5.5-degree temperature increase by 2050.

2015-02-16-childslavecarryingwatersourcekazakhnomad.wordpress.comccr264.jpg A child slave carries water. source kazakhnomad.wordpress.com

OO Climate Change Pushes India's Poorest Children Into Slavery - Disasters resulting from climate change are pushing poor Indian families into poverty and children trafficking.

*
*
*

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-02-16-forestChileanalercemehccr250.jpg
Trees: Giant carbon storage creatures.

OO Scientists Seeking To Save World Find Best Technology Is Trees for sucking CO2 out of the atmosphere and storing it.

OO Communities Create Timber Company To Protect Sumatran Forest - planting, instead of logging trees, in and around villages.

2015-02-16-tongkonanhousesulawesiwikipediaccr264.jpg
The dramatic Tongkonan houses in Sulawesi, Indonesia, are built from forest materials. Wikipedia

OO Sulawesi Communities Build Big, Unique Houses
By Sustainably Managing Forests

OO Indonesia: Despite Green Promise, Forestry Giant Destroys Forests, Peatlands - the culprit is Asia Pacific Resources International Ltd (APRIL).

@@ Video: Innovative Tourism Helps Protect Forests In Amazonian Peru

OO Indonesia: Community Managed Forests Have 11 Times Lower Deforestation Rate - than land outside their borders, says a new study.

OO Scientists Warn Investors On Cacao Company's Forest Destruction In Peru

OO Norway Asked To Divest From Forest-Destroying Company linked to a corrupt Malaysian official, who accrued wealth through destructive exploitation of Borneo forests in Sarawak.

2015-02-16-birdsofparadise8ofthe39spviaCornellLabofOrnithology.jpg
Papuan forests on the island of Papua New Guinea are home to Birds of Paradise that are found no where else in the world; when the forests disappear, so do the birds. Cornell Lab of Ornithology

OO Rapid Development Threatening Traditional Farms, Forests In West Papua - a system of community protected areas and family agricultural rotation that have maintained their way of life and forests' health for time immemorial is now threatened by government-fostered development.

OO The Amazon's Oil Boom: Concessions Cover A Chile-Sized Bloc Of Rainforest - that will be threatened by large scale destruction by a potent combo of greedy governments and companies, if the previous history of fossil fuel and resource exploitation in rainforests there are any guide.

OO World Bank's Forest Carbon Program Falls Short on indigenous peoples' rights, says a new report, ready to fund projects without adequate safeguards for ensuring the community rights are respected.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this crocus I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Rising Seas, Family Planning Pays, and More!

(1) Comments | Posted February 9, 2015 | 2:46 PM

Today, the Earth got a little hotter and a little more crowded.

@@ Climate Change: The Elevator Pitch

*
*
*

2015-02-09-seaslugscaliforniaCreditGaryMcDonaldcourtestyofUCSantaCruzccr263.jpg
These sea slugs are now invading northern California. Gary McDonald, Courtesy of UC Santa Cruz

OO Pink Sea Slug Masses Migrate To North California As warming waters make it more hospitable to the Dr Seussian invaders.

OO Melting Ice, Warmer Temperatures Linked To
Massive Oxygen Loss In The World's Oceans
10,000-17,000 years ago, and this new research could explain what is currently happening in our oceans today.

Related Headline:

2015-02-09-coralreefNOAAlibraryatFlickrccr263.jpg
What a healthy reef looks like. NOAA library at Flickr

OO Something Really, Really Terrible Is About To Happen To Our Corals - many of them are on the verge of dying from a mass-scale bleaching event, as the ever warming oceans make it ever easier to create the conditions for one.

@@ Everyday Climate Change at Instagram
Bringing you the face of climate change daily

2015-02-09-fightingsealevelriseonHanIslandCarteretAtolloffPNG2.6.2015JeremySuttonHibbertInstagramccr263.png
Jeremy Sutton-Hibbert at Instagram Feb 6, 2015.
A Losing Battle: Locals rebuild a shoreline sea wall of giant clam shells, trying to halt erosion of their very low-lying land on Han Island, Carteret Atoll, off of Papua New Guinea.

Rising sea levels have eroded much coastline of the Carteret islands. Waves have crashed over the islands, destroying what little crop gardens islanders have. When this photo was taken food was scarce, with islanders living on a meager one meal per day diet of fish and coconut. Low-lying Pacific atolls such as this will suffer most from rising sea levels and changing weather patterns.

OO Everyday Climate Change, Now On Instagram

Related Headline:

OO The Making Of A Climate Refugee - As sea level rise sinks Kiribati, it could become the first Pacific nation to face mass exodus.

2014-07-06-populationmatters2green.png

Solving Climate Change and Hunger: Family Planning Pays says a new University of California at San Francisco report. "More than 800 million people on the planet are chronically hungry and climate change is accelerating," said lead author Joe Speidel, MD.

"Ongoing rapid population growth is making it much more difficult to address these serious world problems."

2015-02-09-CountdownposterfromLibraryFoundationofLosAngelesAlanWeisman.jpg
Just as too many people on a truck can make it difficult to get anywhere, too many people on the planet can make it difficult to solve the ensuing problems. Library Foundation of Los Angeles, Alan Weisman

Improving access to family planning could provide up to 29% of needed decreases in greenhouse gas emissions. Reducing the need to increase food production would help stabilize the climate, since crops and livestock production currently produce 30% of global carbon emissions. It would also make it easier to address world hunger.


OO Climate Change Mitigation's Best-Kept Secret:
It's Fairly Easy to Make Big Changes
- and to dramatically slow our methane emissions -- if we make the commitment to do so.

Related Headline:

OO It's Not Too Late To Stop Climate Change,
And It'll Be Super-Cheap
- especially compared to the cost and consequences of inaction.


2015-02-09-LyndonBJohnson500aCourtesyRogerRevellePapersUCSanDiegoccr263.jpg

OO A 50th Anniversary Few Remember:
LBJ's Warning On Carbon Dioxide

* * *

SOLAR KEEPS SAILING

2015-02-09-solarkeepssailingsydneyharbourwikipediaccr250.jpg
Wikipedia

OO Charting Hawaii's Spectacular Solar Growth

OO Latin America's Solar Market Grew 370% in 2014 - installed 600+MW, and will more than triple again in 2015. Ole!

OO Obama Backs India's $160 Billion Solar Push

2015-02-09-solarschoolatRodboroughsourceweyvalleysolar.co.ukccr243.gif

OO U.K. Solar Poised to Cruise Past 5 GW Milestone -650,000+ solar rooftop and ground systems have now been installed, and counting!

*
*
*

2014-05-16-moneybagsgreenmrviaforcechangecomcctw92.jpg

OO US Energy Department Provides $45 Million for Solar Manufacturing

OO US Company Gets $10 Million to Mass Produce Domestic Thin-Film Solar Cells to close in on making household solar power affordable.

2015-02-09-solarinafrica450creditFenixInternationalccr263.jpg

For customers in Uganda, the grid edge is the ability to charge a phone or keep an LED light powered.
Fenix International

OO Company Gets $12+ Million to Grow Solar, LEDs, Batteries and Businesses in Africa

OO Getting It Right: Europe Coulda Saved $100 Billion By
Installing Solar, Wind at Better Sites

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO An Upside Of Cheap Oil -- Countries Are Ditching Their Fossil-Fuel Subsidies

OO US Companies Snag Significant Energy Efficiency Venture Capital

OO Researchers Tout Solar Panels Made With 'Perovskite' Mineral - potentially making household electricity cheaper than ever before.

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO U.S. Wind Power Quadruples in 2014 As Texas Leads

OO The Shift Toward a Decentralized, Distributed Electric Grid Is Already Underway

2015-02-09-Nestthermostatyoutubeccr263.jpg

OO Nest Thermostat Pays for Itself in 2 Years - with a thermostat that learns, yielding new data about energy savings.


OO Hitting the Sweet Spot of Home Efficiency
For Big Savings

OO New Program Will Support Clean Energy And Efficiency For Low-Income Residents

2015-02-09-antifrackingphotoAPphotoMikeGrollccr257.jpg
AP photo, Mike Groll

OO Fracking Set To Be Banned From 40% Of England's Shale Areas

OO China 2014 Coal Output Seen Down 2.5 %, First Drop In A Decade

OO Germany Boosts Onshore Wind Capacity By Record Amount In 2014

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO Scientists Call On Obama To Stop Logging In Old Growth Forests

OO Groups Sue EPA Over Failure To Regulate Emissions From Factory Farms

OO At Vatican, EPA Chief To Talk 'Moral Issue' Of Climate Change

Informed Leadership:

2015-02-09-soilmoisture2satellitesolarpoweredSMAPartistsrenditioncreditNASAccr263.jpg
What the solar powered soil moisture satellite will look like in space. Credit NASA

OO As Global Warming Evolves, NASA Launches Soil Moisture Satellite

OO Pennsylvania's New Governor Will Ban Fracking In State Parks And Forests

* * *

2015-02-09-greenamericanflagwavinggreenccr263.png

OO Obama Budget Aims to Make Solar and Wind Incentives Permanent

OO Scotland Just Announced An Indefinite Ban On Fracking

Insights:

OO Accelerated Ice Melt Causing Iceland to Rise which could affect its volcanoes and hastening eruptions that disrupt air travel.

2015-02-09-supercellthunderstormoverGreatBendKSCreditLanePearmanatFlickrccr263.jpg
A supercell thunderstorm. Credit Lane Pearman at Flickr
Thunderstorms Help Bring Ozone Down to Earth, where it contributes to global warming, reports Brian Kahn at Climate Central, from its usual haunt high up in the atmosphere, where it acts as a UV shield. Research indicates that under continued climate change, storms could increase up to 40% by 2100 over the US, shifting planetary ozone function from shielding UV to accelerating global warming.

OO Climate Change USA: Snowier Winters, But Less Snowy Springs

OO Southern Forests' Ability To Suck Carbon From The Air May Be Slowing

2015-02-09-CaliforniaSierrasnowpackMammothmountainwww.kcet.orgccr263.jpg
Snowpack in the California Sierras. Source: www.kcet.org

OO Scientists See Shrinking California Snowpack As Harbinger - with future warming reducing California's natural water reservoir - its mountain snowpack - by more than half by 2100.

Good Ideas:

2015-02-09-solarkeepsrising467solarpvsunrisesourceGreenTechMediaccr243.png

OO Making a Marketplace For Renewable Energy:
Utilities as Matchmakers
- matching up communities and farms with excess solar power with businesses wanting to buy that power.

2015-02-09-naturalcapitalfreshwaterMaliauFallsinBorneoRhettButleratMongabayccr263.jpg
One global source of natural capital: fresh water. Rhett Butler at Mongabay.com

OO Accounting For Natural Capital On Financial Exchanges

OO Chinese Developers Get Active Building Passive Energy Homes

OO Save The World?
Less Beef And Travel, And Eat More Vegetables
- mom was right.

* * *

WHAT DOESN'T WORK

2015-02-09-CoalburnsinChinapeasantstovecreditSeanGallagherinstagram2.4.2015ccr263.png
Sean Gallagher at Instagram
Coals burns in a peasant's stove in China, which produces 46% -- and burns 49% of total global coal (US EIA). Greenpeace notes online that, "a third of all CO2 emissions come from burning coal. It's used to produce nearly 40 % of the world's power."

Fossil Fuel Follies

OO Drought-Stricken California Let Oil Companies
Inject Waste Into Drinkable Water Sources

OO Millions Of Gallons Of Oil Settled
On Gulf Sea Floor After BP Oil Spill
and continue to wreck the ecosystems there.

OO Pennsylvania: Fracking Companies Regularly Commit Serious Environmental Violations

2015-02-09-tarsandsAlbertaoilgoesintopondfromAtlanticSep2014photoessayReutersToddKorolccr263.png
@@ How to Make a Moonscape on Earth: The Alberta Tar Sands - a photo essay. Todd Korol at Reuters

OO W Virginia: Pipeline Explodes With Huge Fireball making this the 4th major mishap at a US pipeline in a month.

2015-02-09-pipeline450alaskawikimediacommons.jpg Wikimedia Commons

OO The Pipeline Fight Does Not Stop With Keystone XL - other pipelines equally or more dangerous are in the works.

OO Oklahoma: Nearly Daily Earthquakes Connected to Fracking
Shaking Up Communities


2015-02-09-extremeweatheracompositeUSAmeharte.png

The damage costs of US extreme weather will continue to escalate under climate change.

The Cost of Climate Change:

OO Earth's Dashboard Is Flashing Red--Are Enough People Listening?

OO Obama Orders Rising Seas Built In to Building Standards

Falling Short on Leadership:

2015-02-09-biomassharvestingofUSforestscctw86.png
This is what's happening to American forests, so Europe can burn them up as wood pellets.

OO Obama's Climate Plan Threatens US Forests - Regulating emissions and clean energy? Yes. Promoting the burning of our forests for biofuels - and saying it's "carbon-free"? No!

OO Evangelical Senator James Inhofe Says Only God Can Cause Climate Change
OMG! You mean God burns fossil fuels? God help us if Inhofe's in charge of the US Senate Environment committee.

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2015-02-09-anomaltempfeb092015.png

Daily Climate Change: Global Map of Unusual Temperatures, Feb 8, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures; although an atmospheric river dumps rain in California, warmer temperatures prevent much of that water to be stored as snow in coastal mountains, and so the drought continues.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

2015-02-09-majorblizzardnortheastUSJan282015CreditNOAAccr263.jpg
A major blizzard covered the northeast US recently with snow; such extreme blizzards are predicted to worsen in intensity and frequency under continuing climate change. NOAA

@@ Picture This: So Much Snow

OO Global Warming Could Make Blizzards Worse

2015-02-09-USmapdividedbywarmingseasonsclimatecentralccr263.png
Don't bother clicking -- go here to play with this. Fastest warming seasons by state: only in Texas is summer warming the fastest. NOAA

The US Is Divided by Seasons and Warming reports Brian Kahn at Climate Central, but every season has been warming since 1970 throughout the US, and the rate of warming has accelerated. In summer, the Lower 48 has warmed by 0.4°F per decade, while the winter has warmed slightly faster: about 0.6°F per decade.

2015-02-09-Australiaheatsup50020130711.png

Climate Change Will Hit Australia the Hardest reports Oliver Milman at the UK Guardian, possibly on track for a rise of more than 5°C (10oF) by 2100, outstripping the warming rate in the rest of the world, says the most comprehensive analysis ever produced of the country's future climate.

OO Climate Change In Minnesota: More Heat, More Big Storms


Social repercussions:

OO Climate Stresses Push Kashmir's Poor Into Militancy,
Pakistan Experts Warn

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon


2015-02-09-birdsofparadise8ofthe39spviaCornellLabofOrnithology.jpg
Papua New Guinea is home to many species of Birds of Paradise that are found no where else: as those forests disappear, so do they. via Cornell Lab of Ornithology

OO Deforestation May Be Accelerating In Papua New Guinea

OO Indonesia: Sumatran Community Takes Charge To Protect Its Forest


OO After 10 Years Vying For Protection,
Kalimantan Community Granted Legal Rights To Its Forest
- communities are key in protecting forests.

2015-02-09-tigersiberianRhettButleratMongabayccr263.jpg
Wild Siberian Tigers are now only found in part of Russia and a northeast province in China.

OO China Tries Out Logging Ban In Northeastern Province

OO 155 Chinese Nationals Arrested For Illegal Logging In Myanmar

OO Radical Transparency: Tracking Deforestation Through Satellite Imagery

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this Chilean protea I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

2015-02-09-DSCN6244.jpg This is even more colorful when brilliant orange Chilean bumble bees visit the...
Read Post

Climate Change This Week: The Midwest Threat, Green Money Flows, and More!

(0) Comments | Posted February 2, 2015 | 3:09 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-02-02-globalwarming570comicsnonsequitor2jan312015ccr262.png
Gocomics.com

"whether an event is caused by climate change
... is the wrong question.
All weather events are affected by climate change
because the environment...

Read Post

Climate Change This Week: State of the Climate, Solar Rise, and More!

(0) Comments | Posted January 26, 2015 | 3:07 PM

Today, the Earth got a little hotter, and a little more crowded.


OO A "Cheesy Love Story" : The Fun Ad Doritos Doesn't Want You to See - palm oil is bad for people and our carbon-storing rainforests. It's in Doritos.

Related Headline:

OO Fake Doritos Ad Pressures Pepsi Over Palm Oil Policy

* * *

The State of the Climate

Takeaways:

* Our global "water insurance," glaciers, are melting away.

* Sea level rise: 8 inches over past century -- now, rising much faster.


"The Fuse is Blown":
Glaciologist's Jaw Dropping Account of a Shattering Moment

Eric Rignot co-authored a paper last spring showing that large areas of the West Antarctic Ice sheet are now in "irreversible decline" -- think irreversible sea level rise....

* Things are changing FASTER than the science predicted.

But we can act to address this fast - the solutions are relatively cheap!
Will you be part of the solution?

2015-01-26-oddsthathottestrecordedyearssince2000arenotrandomwarmingvariationccr261.png
Just how likely is global warming man-made, not random variability?

OO Go Figure: Figuring the Odds of Earth's Hot Streak of Years - by statisticians on the warming being random, rather than man-made.

OO EPA Plans Oil and Gas Methane Emissions Cuts - up to 45% by 2025 (from 2012 levels) Well, that will hack away at a future source ... but what about present sources from fossil fuel operations - and from the tundra due to global warming?

SOLAR KEEPS RISING

2015-01-26-solarkeepsrising500solarsunrise.jpg

OO Solar Power On The Rise - As the cost of solar power continues to fall, the market booms worldwide: in many parts, it is now cheaper to produce solar power than fossil fuel or nuclear energy

2015-01-26-solarpvconstructionworldwideccr261.png

OO USA: Solar Is Cheaper Than the Grid
in 42 of the 50 Largest Cities
- and in almost all of them, solar is a better investment than the stock market.

Related headline:

OO Report: Forget Stocks, Invest In Solar Panels

2015-01-26-solarjobs620xsourcewww.popularresistance.orgccr261.jpg

OO Solar Is Adding Jobs 20 Times Faster Than the Broader Economy


Related Headline:

OO The Solar Industry Created More Jobs In 2014 Than Oil And Gas Extraction

2015-01-26-rooftopsolar310_200SourceGreenTechMediaccr261.png

OO US South Goes Solar:
Bipartisans Support Solar Spread in Florida & Georgia
- from tea partyers to liberals.

2015-01-26-Solarhomesale310xresaleSourceGreenTechMediaccr261.jpg

OO Host-Owned Rooftop Solar Improves a Home's Resale Value - says a new study.

OO CA: Another Big 550MW Solar Farm, Desert Sunlight, Goes Online - as California adds solar capacity in half-gigawatt chunks.


OO US SunEdison Plans $4B Solar Factory, 5GW of Projects - In India

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2015-01-26-uselessenergycutasthmaccr261.png


OO Save Energy --> Cut Pollution --> Cut Children's Asthma - is the message that really works to get people to cut home energy use, says a UCLA study.

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

OO US Produces More Wind Power Than Any Other Nation President Obama said in his 2015 State of the Union address, notes the Power of Wind team at the American Wind Energy Association. We also make the most productive wind turbines, but all that is threatened by the recent cut of the federal Production Tax Credit in Congress.


OO Americans Getting More Serious About Global Warming As A Priority - says a new Pew Poll, but at 22nd place in the list of 23 top policy priorities, you might wonder how - 38% of those polled put it on the list, however, and that's a popup of almost 10% from last year.

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO Maine: Green-Energy Inspiration Found on a Danish Island - Maine's Monhegan stands to learn from the Danish energy-independent island of Samso.

OO California Takes Lead In Developing Energy Storage - mandating enough stored energy in its utilities to power 1 million homes.

OO US Automakers Keep Rolling Out Electric Vehicles


2015-01-26-ChinatrafficBeijingWikipediaccr261.jpg
The many, many reasons why China is cutting subsides for polluting non-electric cars. Wikipedia

OO China to Cut Subsidies for Non-Electric Vehicles

OO Soon 80% Of Canada Could Have A Carbon Price


OO Mines Worldwide Becoming Important Market for Renewables - both as providing solar/wind power sites on deserted lands, and powering current operations with clean renewables.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:

OO Poland's Shale Gas Revolution Evaporates In Face Of Protests


OO W VA: Facing Backlash, Board Of Education Votes
For an Accurate Climate Change Curriculum

2015-01-26-pipelineprotestmar22014.jpg


OO Activists Rally Across USA: Call On White House To Reject Keystone XL


OO Religious Activists Tell Republicans To Get Religion On Climate Change

Insights:

2015-01-26-peatswampinMalaysianBorneomongabayccr235_resize.jpg
Mongabay

OO Drying And Burning Peatlands Amplify Global Warming

Good Ideas:

OO Biggest Energy Innovation? Go Without - energy efficiency is the invisible fuel.

OO Making Bike Sharing Part Of Public

* * *

WHAT DOESN'T WORK

Fossil Fuel Follies:

OO New - And Worrisome - Contaminants Emerge
From Oil And Gas Wells
- two new hazardous fracking waste chemicals - ammonium and iodide - are pouring into Pennsylvania and West Virginia waterways, a new study shows.

OO Who Needs Lobbyists?
Big Energy Spends Big Ad Bucks To Win American Minds

OO Fracking Plays Dirty - fracking sand companies in Wisconsin are asking to be annexed to cities so country regulations don't stop their growth.

2015-01-26-rateatwhichtheworldburnsoilccr261.png

OO Burning Oil : 2.7 Million Gallons A Minute and Rising - Global oil consumption has never been higher and is rising.

OO Canada: 230,000 People With No Drinking Water After Diesel Spill


2015-01-26-biomasspollutionccr261.jpg
Biomass burning emits greenhouse gases, and is how America is legally burning its carbon-storing forests: turning them into wood pellets and exporting them to European fireplaces.

OO EPA Gives Green Light to Biomass Pollution - a bad idea, made worse when people start defining carbon-storing forests as "biomass." Burning biomass emits greenhouse gases.

Even more emissions occur when OO Biomass Industry Plays With Fire and gets burned.

Related Headline:

OO UK: 'Green' Biomass Boilers May Waste Billions In Public Money

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png
Even elephants can't survive on oil. Credit: Mary Ellen Harte

OO House Passes Sneaky Bill
Attacking Public Health and Environmental Regulations


*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-26-anomaltempjan252015.png

Daily Climate Change: Global Map of Unusual Temperatures, Jan 25, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

2014-07-06-populationmatters2green.png

Nature's Breaking Points: Humanity Has Crossed 4 Out Of 9 'Planetary Boundaries' says a new study, reports Joel Achenbach at the Washington Post, beyond which we are destabilizing our environment and creating an unsafe future for humans in coming decades. The crossed boundaries are the extinction rate, deforestation, atmospheric CO2 levels, and the flow of nitrogen and phosphorous into the oceans.

Although the paper mentions our exploding populations, the authors miss that for what it is: the most obvious crossed boundary of all, and the main force pushing us beyond other boundaries.

2015-01-26-additionaldeathsannuallyfromglobalwarmingsaysWHOccr261.png
An array of human ills, from allergies to depression will increase in a warming world and cause additional deaths, says the World Health Organization.

OO Seven Ways Climate Change Could Really Kill You include allergies, heart attacks, salmonella outbreaks, depression, malaria, diarrhea, heat exposure and malnutrition, all of which will increase as the world warms further, the World Health Organization warns.

Natural Repercussions:

OO Global Warming Linked To More Extreme Weather And Weaker Jet Stream - more directly than ever.

2015-01-26-StatueOfLibertyWavesourceCitizenOfEarthatDailyKos.jpg
Source Citizen Of Earth at DailyKos

Sea Levels Rising Much Faster Than Previously Thought says a new study, reports Seth Borenstein at the Sacramento Bee via AP. The study uses a new method showing that the rise during much of the 20th century was actually underestimated by about 30% -- that is, the rise was slower.

But that means the rise since 1990 to present must be actually far faster to account for current levels. So, the current rise is much faster than previously estimated. Oh-oh.

Related Headline:

OO Sea Level Rise Accelerating Faster Than Thought

OO Earth's Fresh-Water Resources At Risk says a new study.

2015-01-26-hialtitudesouthwestconiferforestinGrandCanyonNPCreditParkWilliamsLamontDohertyEarthObservatoryccr261.jpg
High altitude forest in the Grand Canyon National Park. Credit Park Williams, Lamont Doherty Earth Observatory

Dry Skies Literally Drying Out And Threatening US Southwest Forests reports John Upton at Climate Central, say researchers. Due to drought, the skies are holding so much less water than they could that it is creating a lack of vapor pressure, known as a vapor pressure deficit.

This ends up pulling moisture out of the high altitude southwest forests atop plateaus and mountains. This, added to decreased snowpacks and higher temperatures, is behind ever worsening wildfire seasons there, and increasing loss of forests.

OO Alarm Over Siberian Sea Permafrost Thaw, Methane Leak where a Russian gas company plans to drill - just west of the peninsula where a giant sinkhole was discovered last summer, probably created from methane escaping the melting permafrost.


2015-01-26-fishdieoffsourcewww.dcclothesline.comccr261.jpg
Source: www.dcclothesline.com

OO Mass Die-Offs Of Fish, Birds, Mammals Increasing - some of which are consistent with climate change.

OO 2014 Was The Warmest Year Ever Recorded On Earth

OO Perennial Arctic Sea Ice Continues To Shrink - threatening the planetary summer thermal shield.


Human Repercussions:

2015-01-26-droughtsignprayforrainsourcefacebookccr253.jpg
Source Facebook

OO CA: Drought Fears: Signs Of 4th Straight Dry Year - state and federal water officials sound the alarm, saying that more action will be needed to combat the continuing drought.

OO Los Angeles Basin: Far Higher GHG Methane Emissions Found

OO Fishing Industry Could Lose Up To $41 Billion Due To Climate Change says a new study.

2015-01-26-trematodeparasiticSchistosomawormWikipediaccr261.jpg
A parasitic trematode worm, magnified. Wikipedia

OO Another Reason To Fear Climate Change: You May Get Worms - parasitic ones, like the ones that invade your skin in the tropics.

OO Asia: Climate Change Plagues Nepal In The Himalayan Mountains as melting glaciers deprive it of needed hydroelectric power and change weather, threatening food crops.

OO Pakistan: Climate Change Turning Mountain Communities Into Soup of Hazards - as hotter temperatures that melt glaciers, and heavier rains create far more flooding.

2013-12-08-smog659pxBeijing_Forbidden_City_SmogacreditBrianJeffreyBeggerlyviawikimedia_resize.jpg
Smog over the Forbidden City in Beijing, China. Credit Brian Jeffrey Beggerly via wikimedia commons.

OO Airpocalypse Now: Beijing's Toxic Smog Soars Off Charts. Again.

OO Africa: Global Warming Foments Extremism in Boko Haram - contributing to the ongoing violence.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-26-deforestationinMalaysiaareahitbyespbadfloodingatMongabay.comccr261.jpg
Logging is widespread in Peninsula Malaysia, and in Malaysian Sarawak on Borneo Island.

OO High Deforestation Rates In Malaysian States Hit By Flooding

OO Sarawak Malaysia May Stop New Logging
After Much Deforestation And Corruption

2015-01-26-amazondevastationfromgoldmining500w.jpg

OO Amazon Gold Rush Destroying Huge Swaths Of Rainforest

OO Deforestation Climbing - Along With Fears - In The Amazon

2015-01-26-steakdinnerWikipediaccr261.jpg
The real price of that steak dinner? More climate change, and threats to your health. Try something deliciously green next time! Wikipedia.

OO Global Warming Driver: Rising Meat Consumption
Pushes Farming Past Deforestation
- says a new study.

OO Sulawesi Village Seeks Protection For Sacred Forest
Threatened By Development - it supplies their water and, yes, store lots of carbon.

OO Palm Oil Expansion May Play Role In The Ebola Crisis - as expansion into forests increases likelihood of transmission from wildlife to humans.

Good Conservation Ideas:

2015-01-26-treeclimbingCourtesyTimKovarinPortlandTribuneccr261.jpg
Courtesy Tim Kovar in the Portland Tribune

OO Tree Climbing As A Tool To Build Respect For Forests


OO Sulawesi, Indonesia: Farmers Help Restore Degraded Forests

OO Community Forest Management Attracts International Attention
In Sulawesi, Indonesia

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this stinging plant flower I photographed in Chile. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change: 2014 Hottest Yet, Oceans Threatened, Solar Trees, and More!

(4) Comments | Posted January 19, 2015 | 4:23 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-19-averageglobaltemperaturestimelineatthenytimesccr260.png

OO 2014 Breaks World Heat Record - both NOAA and NASA, federal US science agencies, agree it is the hottest year our planet has experienced since 1880, when records...

Read Post

Climate Change This Week: The Heat Is On, A Wind Power Tree, and More!

(1) Comments | Posted January 12, 2015 | 1:34 PM

Today, the Earth got a little hotter, and a little more crowded.

2015-01-12-annualglobaltemperatureaverageaJapanMeteorologicalAgencyclimatecentralccr259.png
Japan Meteorological Agency is the first of 4 major global temperature recordkeepers to release their data for 2014, notes Brian Kahn at Climate Central.

OO 2014...

Read Post

Climate Change This Week: Foul Fracking Fumes, Solar Sponge, and More!

(1) Comments | Posted January 5, 2015 | 1:41 PM

Today, the Earth got a little hotter, and a little more crowded.

@@ Why the US China Climate Deal Is Real - because their rapid development of fossil fuels, particularly coal, has put them on a collision course with some very, very, hard physical limits - like water.

OO China Plans More Closures Of Coal Mines Through 2016 - closing 2,000+ this year, and limiting itself to 10,000 by 2016.

2015-01-05-FrackingnrschoolplaygroundcredBrookeAndersonatfractracker.orgccr253.jpg
Fracking wells occur all over, such as near schools -- or near you.
Credit: Brooke Anderson at fractracker.org

OO Fracking Fumes: Hazardous to Your Health - Emissions from oil-and-gas production threaten human health significantly. Immediate steps are needed to reduce exposure to the toxic pollution, says a new analysis of studies by by the Natural Resources Defense Council.

2015-01-05-bread2wikipediaccr257.jpg
Wikipedia

OO The Bread Threat:
Warming Will Reduce Wheat Production
, research shows.

2015-01-05-Pope_Francis_2013wikipedia.jpg Wikipedia

OO Pope Francis to Issue Climate Edict


SOLAR KEEPS RISING

2015-01-05-solarkeepsrising467solarpvsunrisesourceGreenTechMediaccr243.png

OO How I Chose to Pair My Solar System With an Electric Car

OO Net-Zero Communities Using Solar Power
Expand In Florida

OO Japan to Build World's Biggest Floating Solar Farm

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg

OO 2014: 4 Key Developments in Distributing Clean Energy

* Germany's Top Utility Chucks Coal, Concentrates on Clean Energy

** Solar Power With Storage Becomes Competitive for a CA Utility

*** New York Plans a Large Scale System of Clean Energy Microgrids

**** Hawaii Demands a Solar, Wind Power Future With Energy Efficiency


OO Employment Drops All Over the Power Sector--Except in Renewables!


OO 2014 Saw Key Developments in Storing Clean Energy - with California making big strides, Tesla's Giga battery factory, and the breakout of new batteries.

The Best Things That Happened To Renewable Energy In 2014 reports Katie Valentine at Climate Progress include:

2015-01-05-solarroadsolarroadinNetherlandsccr257.png
The 230 foot long bicycles-only road will produce enough solar power for 3 homes. From acorns grow...
Solarroad

> World's First Solar Road In The Netherlands

<> Solar Power Efficiency Broke The 40% Barrier!

><> World's Largest Solar Plant Comes Online

2013-11-28-windturbineinstallationinbasinnrangeJuly302013DSCN2164_resizea.jpg

> Scotland Was Totally Powered By Wind For A Month!

<> World's Largest Tidal Array Gets Green Light

><> World's Largest, Most Powerful Wind Turbine Comes Online

2015-01-05-Sunswiftsolarcarwent500kmupto85mphrecordccr257.jpg
Australia: university students built Sunswift, a solar car that went 500 km on a charge, with an average 87 mph speed - fast and far. Now, they're working on making it legal for regular roads. Sunswift

> Solar Car Hits Speed Record, Could Soon Hit The Streets

> Researchers Continue To Develop New Ways To Use Solar - from solar cloth to a solar sponge that can, researchers claim, convert 85% of solar energy into steam.

<><><><>

OO Washington State: Offers Ambitious Cap-and-Trade Plan - one of the most sophisticated and all-encompassing climate-pollution pricing programs.

OO Vermont Closes Nuclear Power Plant to Invest in Renewables

2015-01-05-commutingbybicyclewikipediaccr257.jpg
Already a fixture in some European cities, commuting by bicycle programs are starting to take off in the US. Wikipedia

OO Bicycle Commuting Programs Start Lowering US Emissions
and Enriching US Cities


OO Australia Records Biggest Emissions Drop in Decade
Due to Carbon Tax
- the bad news is that the new Prime Minister axed the tax. BOOOOO!

WHAT WORKS

Speaking Out:

2015-01-05-antifrackingphotoAPphotoMikeGrollccr257.jpg AP Photo/Mike Groll

OO New Yorkers Strongly Approve Of State's New Ban On Fracking

2015-01-05-sheldonwhitehouse50thviaclimateprogress.jpg
OO The Climate Action Senator:
Sen. Sheldon Whitehouse Pushes for Change In 83 speeches
- doing what no man has done before....


Informed Leadership:

OO Obama's Secret Love For Science

Good Ideas:

OO Regional Cap N Trade State Groups:
the Congress-free Climate Solution

*
*
*

WHAT DOESN'T WORK

Fossil Fuel Follies :

2015-01-05-fossilfuelmoney.jpg

OO Fossil Fuel Industry Spent $700+ Million During 2014 Elections - 10 times more than environmental groups.


OO Disused Oil And Gas Wells A Major Source Of Methane

2015-01-05-childrencleanupBangladeshoilspillinwetlandsanctuaryccr257.jpg
AP Photo

OO Barehanded Children Help Clean Up Massive Bangladeshi Oil Spill - in the world's largest mangrove forest, a protected sanctuary for a rare dolphin, as experts arrived to help.

OO World's Top 500 Firms' Greenhouse Gas Emissions Rise 3% from 2010 to 2013, far off the cuts urged by the United Nations to limit global warming, says a new study.

2015-01-05-DeepwaterHorizon_fire_20100421wikipedia.jpg
The massive oil spilled by Deepwater Horizon is replicated every two months on average in Russia. Wikipedia

OO A Deepwater Horizon Every 2 Months:
Constant Oil Spills Devastate Russia

2014-07-06-populationmatters2green.png

*
*

2015-01-05-pigfacegovernmentofAustraliaccr258.jpg
Source: Government of Australia

OO The Population-Pork-Climate Change Connection:
China's Massive Pork Appetite Raises Emissions
- via greenhouse gas emissions from its massive farms, and from the deforestation to plant soybeans, a pig feed. The bad news? Pork consumption is ever rising in China

*
*
*

WHY WE SHOULD ACT NOW: RISING RISKS

2015-01-05-anomaltempjan042014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Jan 4, 2015

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the eastern US and the waters surrounding it, are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, continuing its long drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Natural Repercussions:

OO Earth Could Lose Its Summer Thermal Shield by 2020 (yeah, in 5 years) say experts; an ice-free summer Arctic Ocean would significantly add to global heating, as dark waters absorb the heat from 24-hour sunlight that ice once reflected.

2015-01-05-coralreefscene1DanNortonMicronesia.jpg
Credit: Dan Norton

OO 'Doomed' Corals To Face Worst Bleaching In Decades - as a trade wind cycle winds down in the next few years, accelerating warming and ocean acidification. A recent UN report estimated that warming ocean climes, ocean acidification, and the resulting bleaching events will cost the world economy over a trillion dollars in various resources and services by 2100.

Social Repercussions:

OO UK: Almost 7,000 Properties To Be Sacrificed To Rising Seas over the next century with no compensation to owners, as it becomes too costly to protect them.

2015-01-05-mosquito01tigermosquitocreditJamesGathany_resize.jpg As climate warms, the mosquitoes that carry dengue fever spread ever farther afield. Credit James Gathany

OO Dengue Fever Could Spread to Europe say UN researchers, and expand in South America and Africa due to climate change and urbanization.

OO Malaysia: "Unusually Strong" Rain Causes Worst Flooding in Decades;
100,000+ Flee

OO Irreversible But Not Unstoppable:
The Ghost Of Climate Change Yet To Come


2015-01-05-floodinginPakistanSeptember2014K.M.ChaudaryAssociatedPressccr257.jpg
K. M. Chaudary/Associated Press

OO The Extreme Weather And Climate Events Of 2014 In 13 Photos meteorologically speaking, 2014 saw record heat, record snow, record flooding, record drought, rising sea levels and super typhoons -- and extreme climate events are expected to continue unless humans take action to reduce emissions.

2015-01-05-TwintornadoesJune162014Nebraskamashableattwitterccr257.jpg
These deadly twins devastated parts of Nebraska in June 2014. See the video here.
Mashable at twitter

OO U.S. Could See Damage Of $1.1 Trillion Through 2100
From Sea Level Rise, Storm Surge

OO Land-Based Ice Is Melting Faster Than Thought
-- Raising Sea Levels Faster, Too
- as in Greenland and Antarctic glaciers.

2015-01-05-shrimpplatterviawikipediawikimediacommons_resize.jpg
Research indicates that the wonderful flavor of shrimp decreases as the water in which they grow becomes more acidic. Wikipedia

OO The Taste of Climate Change Coming Soon: Yucky Shrimp - say researchers, who raised the bad tasting shrimp in acidified waters, like those that are expected to occur in the near future; the seafood economy is likely to suffer.

OO Acidic Oceans Threaten World's Mussels - and seafood palates.

California Dryin':

2015-01-05-roadkillbearfishermansdaughteratflickrccr256.png
Wildlife is getting killed as they cross roads more in search of scarce food in California. fishermansdaughter at flickr

OO California's Drought Is Threatening Its Wildlife as animals flee their homes and risk their lives in search of food.

OO Once Desert Springs Are Now Dry As California's drought continues.

2015-01-05-almondmarzipancandycrowbotatWikimediaCommonsviaFlickrccr257.jpg
Marzipan Memories Fading? Almonds are a key ingredient in marzipan. Crowbot at Wikimedia Commons

OO Water Source For Almonds In California May Run Dry - drying up the $11 billion boost to the state economy.

OO Lost California Rangeland Poses Greenhouse Gas Risk - as destruction from human activities replaces these carbon storage systems with ones that emit greenhouse gases

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2015-01-05-rainforestbirdscarlet_macaw_04RButler_resize.jpg
A beautiful inhabitant of Brazilian forests, the scarlet macaw. Rhett Butler/Mongabay.com

OO Brazil's Forests Threatened By 'Chainsaw Queen'
-- the New Agriculture Minister

OO Restored Forests Help Efforts Against Climate Change - conserving and expanding the world's immense tropical forests is the single most promising near-term strategy.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed at the De Hoop reserve in South Africa recently. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: No Forests -- No Farming, Divine Divestment, and More!

(1) Comments | Posted December 29, 2014 | 7:51 PM

Today, the Earth got a little hotter, and a little more crowded.

*
*

2014-12-29-ClimatechangexmascarolersbyNishantChoksiattheNewYorker12.22.2014ccr257.jpg

Climate-Change Christmas Carols - by Ethan Kuperberg in "Shouts and Murmurs" at the New Yorker caught my eye. Okay, I admit I haven't sung any...

Read Post

Climate Change This Week: Bishops Bugle, Latin Solar Salsa, the Price of Heat, and More!

(0) Comments | Posted December 23, 2014 | 12:59 PM

Today, the Earth got a little hotter, and a little more crowded.


@@ The 2014 IPCC Synthesis Report Video - informative, engaging...

OO Study: Hotter Days In US Mean Less Cold Cash - Days that averaged about 77 degrees ended up reducing people's income by about $5 a day when compared with days that were about 20 degrees cooler.

2014-12-23-droughtsignprayforrainsourcefacebookccr253.jpg

OO American Drought: California's Economic Crisis - recent storms are not going to end the 'worst drought in a generation' that is turning much of central California into a dust bowl, and bringing one of the richest states in America to its knees.

2014-12-23-popefrancisandbishopsAPphotoAlessandraTarantinoccr256.jpg
"We express an answer to what is considered God's appeal to take action on the urgent and damaging situation of global climate warming." Alessandra Tarantino/AP Photo

OO Catholic Bishops From Every Continent Call
For 'An End To The Fossil Fuel Era'

* * *

SOLAR KEEPS FLYING, RISING, SAILING, SMILING, SURFING,

2014-12-23-solarkeepssurfing2windsurfingatColvabeachsourcebeachesingoacomapr2012.jpg

OO Texas: Austin Aims for 950MW of Solar Along With Bold Distributed Energy Goals

OO First Solar Plans to Expand US Solar to All
with Community Solar Projects
- and has acquired a solar community project company to do so.

OO Distributed Generation Like Solar Will Double Globally By 2023 says a new report.

2014-12-23-sunwithsombrero.png

Latin America's Breakthrough Solar Year, reports Adam James at GreenTechMedia, is characterized by the fastest growing solar PV market in history. Chile dominates the solar boom, and has the largest merchant solar plant in the world. But the US Company SunEdison is scoring on the action as the major developer behind the boom... way to go, SunEd!

OO Australia Reaches 4GW Of Rooftop Solar PV

OO Solar Rises In Malaysia During Trade Wars Over Solar Panels

2014-01-31-geostellargetcleanenergy.png
* * *

GOOD CLEAN NEWS

2014-12-23-Copenhagen_at_nightRoei.tabakatWikimediaCommonsccr256.jpg
Copenhagen at night. Roei.tabak at Wikimedia Commons

OO Copenhagen Lighting The Way To Greener, More Efficient Cities - a growing wireless network of streetlamps and sensors is saving money, cutting the use of fossil fuels and easing mobility, part of its ambitious goal of becoming the world's first carbon-neutral capital by 2025.

OO Paying For A Healthier Planet - using green bonds to encourage Mexicans to save energy.

OO West Coast States Lead Electric Vehicle Adoption In U.S.

2014-12-23-Chinagreatgreenwallwww.care2.comccr256.jpg
OO Great Wall Of Trees Keeps China's Deserts At Bay a new study says of the massive belt of trees being planted across China's arid north.

OO China Is In A Genuine Retreat From Coal,
Says Ex Energy Secretary Steven Chu

OO Many Govts Now Embrace Zero Carbon Emissions By 2050 - in a historic first.


2014-12-23-goplogohalfgreenelephant220_resize.png

OO Poll: Half Of Republican Voters Back Limits On Carbon - something for the GOP Congress to remember in 2015.

* * *

WHAT WORKS

2014-04-25-DITV507mb2.jpg

Speaking Out:


OO Top Scientists To Media:
Stop Using 'Skeptic' To Describe Climate Science Deniers

OO 'We're Running Out Of Time':
Leading Climate Scientist Unveils Latest Numbers On Climate Change


OO Seattle Billionaire Steps Into Coal Fight - to fund a suit against the Dept of Interior on leasing public land for coal. He's Seattle Seahawks owner Paul Allen.

2014-12-23-localsprotestsouthernoregonpipelineMailTribuneJamieLuschccr256.png
Mail Tribune/Jamie Lusch

OO Oregon: Most Residents Speak Against Proposed Southern Gas Pipeline

OO 11 SenatorsTold EPA How To Make Its Carbon Rule
Cut Even More Power Plant Emissions

2014-12-23-ObamaonStephenColbertReportDec82014ccr256.png

OO Colbert Report: Obama Downplays Keystone Benefits, Highlights Drawbacks


OO Climate Change Should Be A Human Rights Issue announced the International Bar Associatio, able to be challenged in a court of law.

2014-12-23-endangeredgoldenrumpedshrewinEAfricaKenyacoastforestccr256.jpg
The endangered golden rumped shrew inhabits an endangered habitat, an east African coastal forest.

OO Greens Protest, And Company Backs Away
From Kenya's Rare Coastal Forest

OO Groups Call On World Leaders To Stop Incentives For Big Dams which often destroy communities, important habitat, and emit the potent greenhouse gas methane.


Insights:

2014-12-23-choicebetweenactionnoactionviaIPCCviaClimateprogressccr256.jpg
Humanity's choice (via IPCC): Aggressive climate action ASAP (left figure) minimizes future warming. Continued inaction (right figure) results in catastrophic levels of warming, 9 °F over much of U.S.

OO What We Learned About Climate Change In 2014, In 6 Charts - here are two of them, above and below; remember, often climate models underestimate the real effects... and the costs.

2014-12-23-droughtacrossplanetby20812100viaClimateProgressccr256.jpg
Palmer Drought Severity Index (PDSI) for 2080-2099 with business-as-usual warming. By comparison, during the 1930s Dust Bowl, the PDSI in the Great Plains rarely exceeded -3 (see here). Source: Cook et al. and Climate Progress.

* *

2014-12-23-globalweirdinginteractiveishereglobalweirding.ishereccr256.png
The beginning of the global weirding interactive - hint, hint: the spinning ball gets redder as time rolls on...

OO Here's What Will Happen This Century
If We Don't Do Anything About Climate Change
Via cool graphics and animation, Global Weirding helps summarize how the planet may change over the rest of the century, using the most reputable source of information, the latest IPCC report.

OO Greenland's Ice Sheet Shifts Could Speed Melt - the sheet's dynamics are changing, which could ultimately raise sea levels that much faster.


2014-12-23-methaneleakfromoceanflooruseastcoastccr256.jpg

OO Warming Ocean May Be Triggering Mega Methane Leaks Off Northwest Coast as methane that was trapped in crystalline form beneath the seabed melts and is being released. -- and fast.

See also:

OO 'Widespread Methane Leakage' From Ocean Floor Off US Coast

2014-07-06-populationmatters2green.png

OO Mainstream Media - Newsweek - Tackles Overpopulation:
222 Million Women Need Access to Contraceptives
- not just physical access with accurate information about their use and results, but cultural encouragement and freedom.

2014-12-23-orchidcollage550MEHccr245.png
Many orchids are now endangered or going extinct, as we destroy their special habitats.

As it is, our exploding populations are changing the climate and irreversibly extinguishing much of the beautiful tapestry of life on Earth, and our mega life support systems, our ecosystems.

* * *

WHAT DOESN'T WORK

The Legacy of Fossil Fuels, and Their Combustion:

"We have privatized profits and socialized costs"

Fossil Fuel Follies

2014-12-23-santaflyingthrupollutionccr256.png
Santa to Planet Earth: All You'll Get For Christmas Is More Coal - And Global Heat

OO Coal Demand Set To Break 9 Billion Tonne Barrier This Decade

OO Sloppy Fracking Practices Result In Large Methane Leaks

OO Florida Fracking: State Uilities Want You To Pay For It


<><><><>

OO Methane Still Belches From US's Old Oil And Gas Wells


OO As U.S. Cleans Up, It's Exporting More Pollution

2014-12-23-teslaelectricroadsterwwindturbineswikipedia.jpg
A Tesla electric roadster: it can be a lot dirtier than it looks, depending on how the electricity was generated. Wikipedia

OO Without Clean Electricity E-Cars Aren't Clean says a new study; electricity from coal makes them worse than regular gas cars.

OO The U.S. Energy Story: Not a Pretty Picture
A new interactive map of US energy production over the past 20 years shows the biggest growth has been in natural gas, nuclear and biofuels; 2 out of 3 spout carbon emissions....

Ignorance:

OO Most Americans Aren't Aware Of The Health Impacts Of Climate Change

Bad Ideas: Damning Big Dams

OO False Victories For Sustainability: Amazonian Hydropower - there is a rising backlash against the huge economical, environmental, and sociological costs dams bring.

OO Lao Hydro Dam To Seriously Affect Vietnam's Mekong Delta both agricultural and aquatic resources, experts warn.


Delaying Action:

OO Climate Accord Struck In Lima, But Key Decisions Postponed

* * *


WHY WE SHOULD ACT NOW: RISING RISKS

2014-12-23-anomaltempdec222014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Dec 22, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent enough rain from reaching California, where the drought continues.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Social Repercussions

2014-12-23-PerupotatoesimperiledbyclimatechangeMilagrosSalazarIPSccr256.jpg
Peruvian potatoes are imperiled by climate change. Milagros Salazar IPS

OO Climate Change Creates New Geography of Food

OO UN: Drought In Central America Has Pushed 2.5m People Into Food Insecurity

OO Climate Change In Nicaragua Pushes Farmers Into Uncertain World

2014-12-23-endangeredanimals4www.kidsdiscover.comccr256.jpg

OO Earth Faces Sixth 'Great Extinction' As a growing human population and climate change eats away vital habitats.

OO Peru's Melting Glaciers A Deadly Threat As Temperatures Rise - with up to 40% of ice lost, water is filling existing lakes to the brim and spawning hundreds of new ones.

OO Developing Countries Need A Lot More Investment To Adapt To Climate Change

2014-12-23-BeachwithpeoplesurfersSydneyAustraliaWikipediaCommonsccr256.jpg
Endless Summer Ending? The world's beaches are disappearing from human development and climate change. Wikipedia.

OO World's Beaches Being Washed Away Due To Coastal Development increasing, and ever higher sea walls to defend against fierce winter storms and rising sea levels, say two of the worlds' leading marine geologists.

OO Rising Sea Levels Could Make Florida Residents 'Climate Refugees'

OO Waters Warm, And Cod Catch Ebbs In Maine

2014-12-23-prawnsoupwculturedshrimpinVietnamThyKhueLyflickrccr256.jpeg
A special regional soup in Vietnam features the area's cultured prawns. Thy Khue Ly at Flickr

OO Under Current Practices and Climate Change, Aquaculture Boom Is Unsustainable

OO Australia: National Agency Warns Of '$1 Trillion' Natural Disasters Exposure

Nature's Repercussions:

2014-12-23-supertyphoonusaginearsPhilippinesNOAAccr256.jpg
Note that the size of super typhoon Usagi is as large as the Philippines. NOAA

OO Warm Ocean Waters Boosting Typhoons, Record Heat

OO Reindeer Populations Declining Due To Climate Change, study finds.

California Dryin':

2014-12-23-roadkillbearfishermansdaughteratflickrccr256.png
A casuality of the road. fishermansdaughter at Flickr

OO California Animal Deaths Spike On Sierra Roads As Drought Hits Habitat sending bears and deer especially loping across roads and highways this fall, apparently searching for scarce food.

OO California's Drought Probably Wasn't Caused By Climate Change - But Worsened By It indicates new research by the National Oceanic and Atmospheric Administration.

<><><><>

OO Storm Pounds CA, But To The Drought, Just A Spritz

OO California Needs 11 Trillion Gallons of Water to Recover from Drought - ummm, that's 11,000,000,000,000 gallons.

* * *

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

2014-12-23-AmazonrainforestRhettButlerccr256.jpg
Amazon rainforest canopy. Rhett Butler at Mongabay

OO Growth Of Forests May Not Be Keeping Pace With Rising CO2 Levels

OO Forest Conservation Tied To The Rights Of Indigenous Communities

OO Indigenous Communities 'Among The Very Few Best Protectors' Of Peruvian Amazon

2014-12-23-indigenousforestcommunityinPeruAchuarwww.pachamama.orgccr256.png
An indigenous forest community in Peru, the Achuar. www.pachamama.org

OO Deforestation Puts Cultural Survival Of Forest-Dependent Peoples At Risk

OO Indonesia: Huge Borneo Forest Swath To Be Destroyed By 'Sustainable' Company

2014-12-23-bambooinMadagascarRhettButleratMongabayccr256.jpg
Rhett Butler at Mongabay.com

OO Bamboo Could Help Fight Global Warming as a fast growing forest species that can store carbon and repopulate degraded forest, and be harvested for commercial use.

OO An App To Save 400 Million Animals which are essential to the health of the forests that nurture them. The app helps track poachers, traffickers.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by these wildflowers I photographed one spring. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Happy Holidays, Folks!

2014-12-23-DSCN1560a_resize.jpg...
Read Post

Climate Change This Week: New Solar Record, Murder, a Flying Donut, And More!

(0) Comments | Posted December 15, 2014 | 3:28 PM

Today, the Earth got a little hotter, and a little more crowded.

*
*

2014-12-15-orangutanmotherchildhuddledpetrifiedencasedbyhunterscredVierPfotenFourPawsRHOIRexAPccr255.jpg
Vier Pfoten/Four Paws/RHOI/Rex/AP

Palm Oil is Lethal for Mother and Child: This orangutan mother and five year old child huddled, petrified, as bounty hunters closed in...

Read Post

Climate Change This Week: The Munchkin Dilemma, Solar Cash Crop and More!

(3) Comments | Posted December 7, 2014 | 6:06 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-12-07-kidsfromtalltoshort300www.marymoody.com.auccr254.jpg

And They're All the Same Age! Not. But a new study indicates that El Nino, which is exacerbated by climate change, can stunt kids' growth. The grandmother of these kids,...

Read Post

Climate Change This Week: the Pepsi Hijack, Cooling Mirrors, and More!

(0) Comments | Posted December 2, 2014 | 2:35 AM

Today, the Earth got a little hotter, and a little more crowded.

2014-12-02-holdrenonletterman11262014ccr253.png

An Inspiring Conversation on Addressing Climate Change
National Scientific Advisor John Holdren on David Letterman , viewed here.

Takeaways:

There is a huge difference between...

Read Post

Holiday Football? Try Planetary Pinball!

(0) Comments | Posted November 26, 2014 | 2:42 PM

The Pinball Machine of Climate Change

2014-11-26-footballplayercatchesglobeEarthmehccr252.png

I know, I know, it's football season. Across America, millions are planning their Thanksgiving weekend TV football feasts and parties. But before you settle into the couch and start chowing down on...

Read Post

Climate Change This Week: Lightning Increasing, Solar Cloth, and More!

(0) Comments | Posted November 24, 2014 | 2:42 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-11-24-colbertpolarplunge7ccr252.png
Stephen Colbert takes the Polar Plunge here, highlighting the dim lights who don't understand how global warming can create both extremely cold and hot weather.

Read Post

Climate Change This Week: A BIG Climate Pact, Cheap US Solar Soon All Over, and More!

(1) Comments | Posted November 17, 2014 | 6:00 PM

Today, the Earth got a little hotter, and a little more crowded.


South Florida and Sea Level Rise - A Slow Motion Catastrophe - latest in the This Is Not Cool Series by Peter Sinclair.


2014-11-17-USChinaclimatepactmehccr251.png

OO U.S., China Reach 'Historic' Deal To Cut Emissions - it's a long overdue beginning, and no where close to what it needs to be, but for now, "China, I think this is the beginning of a beautiful friendship...."

SOLAR KEEPS RISING

2014-11-17-solarfactsmotherjonesccr251.jpg


Brazilian solar bids roll in at high volumes and low prices to supply solar power to the nation's electric grid, resulting in nearly a gigawatt of new contracts reports Seth Zuckerman at ClimateCast. Less than 10% of the many proposals could be accepted, all at less than 9 cents per kilowatt-hour.

2014-11-17-solarenergyriseinUSviamotherjonesccr251.png


Here Comes The Sun: America's Solar Boom - an energy analyst at Deutsche Bank came to a startling conclusion recently, reports Tim McDonnell at Mother Jones: By 2016, solar power will be as cheap or cheaper than electricity from the conventional grid in every state except three. That's without any changes to existing policy.

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!
* * *

GOOD CLEAN NEWS

OO Green Energy 'Creates More Jobs Than Fossil Fuels' study says.

OO Scotland Produced Enough Wind Energy To Power Every Home In October.


OO LEDs the Fast-Rising Heroes of Efficiency are becoming the affordable and more efficient replacements of compact fluorescent lights.

2014-11-17-cleanenergygridccr251.png


EU Plans 'Supergrid' To Boost Security, Renewables reports Paul Brown at the Daily Climate. The European Union, nervous about Russia cutting off gas supplies and keen to cut emissions by developing renewable energy sources, aims to link all 28 member states to one electricity grid.

* * *

WHAT WORKS

Speaking Out:

2014-11-17-realitydropicon361xclimaterealityprojectccr251.png

You Can Help Fight Climate Change with Reality Drop, a project by the Climate Reality Project, to combat the rampant online misinformation about climate change and its solutions, especially clean energy. It makes it easy for you spread the truth or combat the denial surrounding hotly debated articles in their comment sections. Like a good fight? Here ya go!

OO We Must Manage Climate Risks By Cutting Carbon Pollution,
Top Scientists Conclude

OO Australia: Yawuru Native People Camp Out To Oppose Fracking

2014-11-17-divestprotestsourcedailycollegianFlickrccr231.jpg Source dailycollegian/Flickr

Divestment Movement Growing Among NGOs, Cities reports Seth Zuckerman at ClimateCast. The Oregon Environmental Council shed its dirty stocks and invested in green companies recently. And 350.org's Fossil Free movement enlisted its 30th city worldwide (Orebro, Sweden) to divest its investment portfolio from coal and oil.

The movement is growing, with campaigns up and running in London and eight German cities, and Paris waiting in the wings. Nearly 200 institutions, managing an estimated $50 billion, have pledged to divest since 2011; the number of investment professionals offering fossil-free portfolios has increased more than 50% this year.

2014-11-17-votingccr242.jpg

Where Voters Made a Difference on Climate:

Although the 2014 US elections shifted control of Congress under to a group dominated by climate deniers, who profess to understand nothing about the science, the elections also saw climate change solutions becoming a voting priority, reports Seth Zuckerman at ClimateCast.

Fracking bans won in a Texas oil town, an Ohio college town, and in two of three California counties that voted on the issue. In the northeast, the voter elected Democratic Gov. Tom Wolf of Pennsylvania, who promised to bring his state into the Northeast's Regional Greenhouse Gas Initiative.

2014-11-17-frackingprotestmarch2014CAcapitalRaeBreauxontwitter.jpg Zack Malitz on twitter

OO Americans Are Voting For Fracking Bans -
They Don't Trust The Oil And Gas Industry

2014-07-06-populationmatters2green.png

Creating Sustainable Populations Humanely:


Educating by Entertaining on Population, Health: African Radio - a new soap opera radio series launched in Rwanda aims to engage people emotionally as it confronts taboo subjects and informs on reproductive health and fertility, reports the Institute for Reproductive Health.

2014-11-17-worldvasectomyday600pxwww.glamadelaide.com.au_resize.jpg Doing what's responsible and right for humanity and the planet: getting a vasectomy.

The Latest Climate Change Statement:
Webcast Your Vasectomy
and be counted among the heroes on World Vasectomy Day, which was on November 14th this year, reports Jason Plautz at the National Journal. The day is a worldwide celebration of a different sort of sacrifice: men who get vasectomies.

Learning More About Climate Change:

2014-11-17-climateeducationgettingthepictureinfoccr251.png

OO Getting the Picture: Our Changing Climate - a learning tool for students and educators.

Good Ideas:

OO A Web Vacuum That Sucks CO2 from Your Email - at gmail, by identifying all those 1,000s of old emails you have yet to clean out of your email box; storing them uses up energy. Check it out here.

OO Scientists Create First Detector
Of Fracking Contamination In Water
- they can trace leaks and spills of fracking fluids--and even detect their presence in treated water.

*
*
*

WHAT DOESN'T WORK

Fossil Fuel Follies:

2014-11-17-fracking375aoilfieldpumpjackscreditUniversityofTexasviaCPcctw96.jpg

OO US Energy Boom Might Be A Short One since the majority of the country's shale oil and gas reserves could prove too deep and too expensive to drill.

OO Cheap Oil Bad For Carbon Cuts -
And For Fossil Investment, Too

2014-11-17-oilrefinery486USmapfromearthjusticeccr251.png

How close does your family live to an oil refinery? It's a Matter of Health
Find out on this interactive map here. Earth Justice

OO Rich Countries Subsidising Oil, Gas And Coal Companies $88 Billion A Year

2014-11-17-USsubsidizesoilexplorationUKguardianinteractiveccr251.png
This is where the US is subsidizing exploration for oil we cannot afford to burn - the US, and Russia -- and Putin's buddies. To see where others are subsidizing this, go here:

OO How The G20 Subsidises Exploration For Fossil Fuel - Interactive

2014-11-17-babyconcernedbyAjsmen91atWikimediacctw90.jpg
Ajsmen91 at Wikimedia Commons

OO Air Pollution Exposure Can Drastically Increase
A Child's Chances Of Developing ADHD


2014-11-17-vegetablesfruitswikipedia.jpg
Wikipedia

OO Affordable Food or Cheap Gas? Choose One as food and fracking corporations fight for the same precious resource, water.

OO India: Air Pollution 'Cutting Crop Yields By Almost Half'

OO China's Reliance On Coal Costs Over 600,000 Lives A Year says a new study.

Clueless Leadership:

2014-11-17-pollutionfromcoalpowerplantsourceRTCCccr231.jpg Republicans do not want to regulate this pollution. Source RTCC

OO Senate Republicans Vow To Dismantle Carbon Emissions Rules

OO Climate Change Denier Jim Inhofe (R)
In Line For Senate's Top Environmental Job

OO GOP Election Rout Delivers Blow To US Leadership On Climate Change

Inadequate Action:

2014-11-17-extremeweatheracompositeUSAmeharte.png
Even capping warming at 2 C will not prevent even more extreme weather in the future many scientists now say - unless we move dramatically to cut emissions via a transfer to clean energy and greater energy efficiency.

OO Capping Warming At 2 C Not Enough To Avert Disaster, many experts warn.

OO Cutting Methane, Soot Not Enough to Tackle Warming

OO Australia 'Losing Out' On Renewable Energy Investment - renewable energy investments there has dropped by 70% in the last year, says the national Climate Council, as foreign investors go elsewhere because the government has no clear renewable energy policy.

Faith in Techno-Fixes:

OO Many Experts Now Say: Technology Can't Fix Climate Change

Not Speaking Out:

2014-11-17-Sushiplatterwikimediacommonschidorianofjapanviaflickr.jpg This could be a bittersweet memory decades from now, if we don't halt ocean acidification. chidorian of japan/Flickr

OO Censored: Acidification Tops List Of Important Stories Ignored By Media

* * *

WHY WE SHOULD ACT NOW: RISING RISKS

2014-11-17-anomaltempnov172014.jpg

Daily Climate Change: Global Map of Unusual Temperatures, Nov 17, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US switched suddenly to abnormally cold as a massive Arctic front moved in. This will happen increasingly often under climate change, as melting Arctic ice creates conditions that slow Arctic winds (the jetstream) and make their geographic patterns ever more wavy - with some of those big "waves" pushing Arctic cold deep into the US.

2014-11-17-droughtBrionesReservoir2jan52014cctw89.jpg
California reservoirs remain low as the drought continues.

Meanwhile US waters and the far north are experiencing warmer than normal temperatures, with Alaska warmer than Texas on some days. The eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.

Extreme Weather:

OO 2014 Will Go Down As Hottest In California's History

OO Heat,Drought Worsen Smog In California, Stalling Decades Of Progress


Social Impacts:

2014-11-17-Boychild500_receiving_treatment_after_Haiti_earthquakewikipedia.jpg
Wikipedia

OO From Bar Fights To Wars, Climate Change Will Make Us More Violent

OO Hostages Of Climate Change: Trapped Poor Populations - the range of climate change calamities projected by many scientists - from floods to heatwaves and rising seas -will take its heaviest toll on the poor.

OO US: 'Nobody Is Truly Ready' For Rise of Seas

2014-11-17-cornwitheredaatexas2013USDAatFlickrccr251.jpg
USDA at Flickr

OO China: Drought Ends Run Of Record Corn Harvests

OO UK: Drought And Flood Fears After Warm 2014

2014-11-17-beeEuropean_honey_bee_extracts_nectar.jpg

OO Climate Change Disrupts Bee's Pollination of Flowers - with increasing global temperatures to blame, says new research..

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon

OO Peru Has Massive Opportunity To Avoid Emissions From Deforestation

2014-11-17-monkeyMalaysianmacaquecredRhettButlerccr251.jpg
A once rare malaria is on the rise in Malaysia as carrier monkeys, fleeing deforestation, encounter people.
Rhett Butler at Mongabay.com

OO Human Infections By 'Monkey Malaria' Increasing
As Forests Disappear


OO Central Africa: Chinese Companies Wreaking Environmental Havoc - as they exploit without oversight.


OO Reducing Tax Evasion Could Help Save The Amazon - through taxing already cleared, underused land, says a new study.

2014-11-17-treerootsmangoCreditAaronEscobarviaWikimediaCommonscctw96.jpg
Aaron Escobar via Wikimedia Commons

Brazil: Global Meat Demand Plows Up Vast 'Underground Forest' reports Autumn Spanne at the Daily Climate. Far more threatened than the Amazon forest, the vast lands of the Cerrado have deep roots that store vast quantities of carbon -- but industrial farming is releasing this fast.

YOU CAN ACT to protect our homeland:

From re-elected Iowa State Senator Rob Hogg (Facebook: "Climate Action Across America"):

If 400,000 people can march for climate action in New York City, we can get 100 people to contact every Congress person by phone, email, or in person:

urge them to oppose the Keystone "export" pipeline and to act on climate.

It is okay to contact their offices regularly, and to invite others to contact them - they need to hear from Americans about the growing support for climate action.

<<1>> Please tell them we already have too much greenhouse gas pollution in our atmosphere, and building Keystone would make it even worse.

2014-11-17-farmswateratriskfromkeystoneccr251.png
The Keystone XL Pipeline would sacrifice American farms and endanger our water, so that a foreign company could export oil. Is this fair?

<< 2 >> You can add that Keystone would:

sacrifice American farms and ranches through eminent domain
and endanger our water -
just to let a foreign company export oil.

That would be #BadForClimate & #BadForAmerica, so say #NoKXL.

<< 3 >> Tell them to help US Wind Power instead: urge them to extend the Wind Energy Production Tax Credit.

Then let Rob know that you did it.

Finally, Endorse the EPA Carbon Pollution Rules here << Comment Deadline December 1 >> and be sure to copy your Congressional representative and Senators.

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this autumn tundra I photographed years ago. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post

Climate Change This Week: Ikea Sells Solar, IPCC's Urgent Report, and More

(2) Comments | Posted November 10, 2014 | 1:26 PM

Today, the Earth got a little hotter, and a little more crowded.

2014-11-11-Colbertrepublicansinspiringmessageonclimatechangeccr250.png
Screen capture of Facebook Timeline Photos
Stephen Colbert: The Republicans' Inspiring Message on Climate Change --
You, Too, Can Be a Non-Scientist! To see this hilarious video...

Read Post

Climate Change This Week: Coal's Creepy Cancer, Saving Capitalism From Polluters and More!

(2) Comments | Posted November 1, 2014 | 11:44 AM

Today, the Earth got a little hotter, and a little more crowded..... bwahahahahahaha!!!!!
Hmmmm.... Actually, this really IS scary....

2014-11-01-tempanomaliesforSept2014NASAccr247.jpg


Fossil fuels are turning our planet into a pretty scary Jack o' Lantern. Vote for clean energy leaders on...

Read Post

Climate Change This Week: Driving Fast n' FREE on Solar, Record Rising Seas, and More!

(2) Comments | Posted October 20, 2014 | 7:37 PM

The EV Revolution Is Here!

Takeaways:

2014-10-20-solarparkinglotsPeterSinclairvideoEVRevolutionccr247.png

If we covered the 800 million US parking spaces with solar panels,
the output would be three times the US transportation energy requirements.
We're wasting sunlight.

- notes Desmond Wheatley, CEO of Envision Solar

Build a network of solar powered charging stations,
Where cars can get recharged for free.

- is a goal of Elon Musk, Wunderkind CEO of Tesla.

2014-10-20-electricvehicleEVrevolutionfromSinclairvideoEVRevolutionccr247.png
A Nissan Leaf Ad: Electric cars can already go 257 miles on a charge, accelerate faster than regular cars, and cruise at 80 mph or more.

SOLAR KEEPS ZOOMING

2014-10-20-solarmoney.png

SolarCity Will Finance US Home Solar
To Make Rooftop Systems More Affordable
reports Jeff Spross at Climate Progress. Financing installations will overcome the hurdle of ownership costs. Its CEO predicts that such lease-like loans could be half of their new business by the end of 2015.

OO Florida: Thousands of Clean Energy Jobs at Risk - if state caves to pressure to gut energy efficiency goals.

OO Mexico: 250 MW of Distributed Solar Power to Be Developed

OO Australia Commissions 'Oceania's Largest' Solar Farm

OO Keystone XL's TransCanada Buys 3 Solar Plants from Canadian Solar; now all they have to do is transfer their product line completely to clean renewable projects, and clean up their tar sands mess... come on, TC (aka Tarry Calamity), you can do it!

2014-01-31-geostellargetcleanenergy.png
Check it out here, right now!

GOOD CLEAN NEWS

2014-03-14-cleanenergybulb500solutionsideabulblead972x514viaclimateprogresscctw97.jpg


Raw Materials Are No Bar To Renewable Energy Future reports Seth Zuckerman at ClimateCast. Shifting world electricity production to renewable sources would reduce air pollution and require a manageable quantity, says a new peer-reviewed life-cycle assessment.

Such a transition would save $1.8 trillion over the next two decades, says a study by the Climate Policy Initiative, which also found that governments and taxpayers will bear the greatest financial risk if fossil fuel reserves are stranded underground.

2014-10-20-solarsunrise.jpg

This research follows a pair of studies by the International Energy Agency foreseeing that solar power--in a combination of photovoltaic and solar thermalplants--could supply more than a quarter of the world's electricity by 2050.

OO Efficiency Gains Over The Last Decade Saved More Energy
Than China or US Consumed In 2011
- and that's for just the advanced countries...

OO Besides Cleaner Energy, Renewables Are Much Greener to Build says a new study.

2014-10-20-teslaelectricroadsterwwindturbineswikipedia.jpg
Wikipedia

Americans' Cars Are More Fuel-Efficient Than Ever reports Katie Valentine at Climate Progress. Plus, electric vehicle sales are up in the U.S., and the percentage of Americans who drive to work is down. The EPA announced a new gas mileage record for US cars and trucks: 24.1 mpg! Although gains are slowing as more people own SUVs and trucks.

2014-10-20-nobelprizemedalccr247.jpg

OO The Inventors Of A 'Revolutionary' Climate Solution
Just Won A Nobel Prize


OO CA's Drought Cuts Hydropower By Half
But Wind, Solar Help Fill the Gap

OO Northern Chile Has Top Renewables Market

WHAT WORKS

Speaking Out:

2014-10-20-flyfishingPeterforsythatwikimediacommonsccr247.jpg
Peterforsyth at Wikimedia Commons

OO Hundreds Of Hunting And Fishing Groups
Speak Out For Action On Climate Change

2014-10-20-LEGOShellOilprotestcontestmyslogangreenpeaceccr234.png


OO Greenpeace Sinks Lego's Deal With Shell Oil Over Arctic Drilling - which included having toddlers get their plastic cars "filled" at Shell Gas stations... makes your heart curdle, just thinking about it...

OO Glasgow Becomes First University In Europe To Divest From Fossil Fuels

2014-10-20-nobelprizewinnersonsustainabilityccr247.png

OO Nobel Laureates Call For A Revolutionary Shift
In How Humans Use Resources

2014-10-20-climaterainbowacrucifixccr227.png

OO Australian Anglicans Join Divestment Movement

OO Orange Country, CA: Growing Numbers Call for End to Fracking in GOP Area


Good Ideas:

2014-10-20-unbalancedscalesgr400wikipedia.png

International Lawsuits Could Punish Carbon Emitters
Even If Governments Don't
reports Jeff Spross at Climate Progress. Improving climate science and the workings of international litigation could make courtrooms the next climate change battlefield, according to a new report.

OO We Can Meet 2C Climate Target,
But Success Depends On Immediate Action
say energy experts.

2014-10-20-supersavingswhenyouactonclimatechangenowccr236.png

OO Americans Can Save More Money By Not Burning It on fossil fuels, says a new study, through energy efficiency and accelerating a switch to clean energy - or pay far more later from ever worsening climate catastrophes.


New Insights:

2014-10-20-FTFmoresigns500ofchangefromthegrandrapidfloods04.26.2013575514_507190535995687_1895225914_n_resize.jpg


OO Sea Level Rise Over Past Century Unmatched In 6,000 Years says study.

OO NOAA: Record Antarctic Sea Ice Growth Linked To Its Staggering Loss Of Land Ice as the freshwater flow from melting glaciers lowers the freezing temperature in the surrounding sea.

YOU CAN ACT

2014-10-03-voteforcleanenergyleadersccr245.png

Be A Climate Voter November 4 - the most important things you can do right now to promote climate action are register, vote, volunteer, and speak up publicly as a climate voter.

Please let candidates and the news media know that you are looking for candidates who will support climate action.

Speaking up makes a big difference. As one elected state senator notes,
"it is always reassuring to me as an elected official when my constituents tell me they support my work to promote climate action and sustainability, and it encourages me to do more.." Iowa State Senator, Rob Hogg.

Volunteer at a "climate voter" effort: the League of Conservation Voters, NextGen Climate, Climate Hawks Vote, and Vote-Climate.

Great March for Climate Action - a cross-country march from Los Angeles to Washington, DC, to support climate action - is now in Pennsylvania and scheduled to arrive in Washington, DC, on Saturday, November 1. You can join at any point for however long -- go here for details.

EPA Carbon Pollution Rules - Please Comment: Many groups are collecting signatures and comments in support of these rules; you can send comments directly to the EPA here.


Join the Citizens Climate Lobby.

2014-10-20-votingccr242.jpg

Pledge to VOTE here, then

MAKE A PLAN TO VOTE so that the daily demands of life doesn't sidetrack you. Here's a checklist to help:
* What time of day are you planning to vote on Tuesday, November 4th?
* How are you planning to get to the polls?
* Are you planning to bring the kids with you? Yes / No

Thinking through your plan to vote now makes it more likely that you'll vote on Election Day.
Need info on where you should vote? Go here.


WHAT DOESN'T WORK

Fossil Fuel Follies:

2014-10-20-smokestacksbehindhousesPeterEssickDec2013yale360climatechangephotoessay.jpg
Your dollars, going up in smoke, bringing you pollution and climate change.
Peter Essick

OO Bank of England Governor: Most Fossil Fuel Reserves Can't Be Burned - so coal, gas and oil assets are at risk of economic collapse.

OO Biomass Energy: Another Type of Climate Change Denial

2014-10-20-methanehotspotatthe4cornersNASAJPLCaltechccr247.jpg

US Methane 'Hot Spot' Is Huge, But It's Nothing
Compared To Our Other Methane Sources
reports Emily Atkin at Climate Progress. A new study highlights the discovery of the spot, created from natural gas projects, but much more US methane, a short term but very potent greenhouse gas, is emitted yearly from U.S. agriculture, land use, forestry, landfills, and energy production in general.

OO Methane Emissions Soar In Drilling Boom

OO Growing Fracking Dilemma:
How To Dispose Of Radioactive Oil And Gas Waste?

2014-10-20-tarsandexplorationAlbertaCanadaviaRTCCccr239.jpg
Tar Sands Mining: The fossil fuel industry doesn't want you to think that this is dirty.
Howl Arts Collective at Flickr

OO Intense Industry Pressure Causes European Union
To Stop Calling Tar Sands Dirty

OO US Oil Trains Now Delay Transport of
Vital Consumer and Industrial Goods

Clueless Leadership:

2013-11-28-goplogodeadwithoildropw220_resize.png
Even elephants can't survive on oil. Credit: Mary Ellen Harte
<><><><>

OO Three GOP State Legislators Want To Kill
Michigan's Popular Clean Energy Law



OO Fossil Fueled 'Scientist' Congressman: There's No Manmade Climate Change - says this professional medical GOP doctor, supported by the fossil fuel industry. Remind me to consult a climate scientist the next time I feel sick... which is right about now...

OO Senate GOP Candidate: Yeah, We Cause Climate Change - So What?


WHY WE SHOULD ACT NOW: RISING RISKS

Today, the Earth got a little hotter, and a little more crowded.

2014-10-20-anomaltempoct202014.jpg


Daily Climate Change: Global Map of Unusual Temperatures, Oct 20, 2014

How unusual has the weather been? No one event is "caused" by climate change, but global warming, which is predicted to increase unusual, extreme weather, is having a daily effect on weather, worldwide.

Looking above at recent temperature anomalies, much of the US and the waters surrounding it are experiencing warmer than normal temperatures: the eastern Pacific warm spot continues to prevent much rain from reaching California, sending it into further drought.

Much of the areas surrounding the North Pole are experiencing much warmer than normal temperatures - not good news for our Arctic thermal shield of ice. Hotter than usual temperatures continue to dominate human habitats.


2014-10-20-fishskeleton500butterflyfishWikipediaccr247.jpg


OO 'The Other CO2 Problem':
How Acidic Oceans Will Cost Our Economy Billions
- and $1 Trillion annually worldwide, a U.N. report predicts, if carbon pollution is not curbed

* *

2014-10-20-tempanomaliesforSept2014NASAccr247.jpg
OO September Was Warmest on Record, NASA Data Shows

OO California Could Be Facing A Mega-Drought - think 30 to 100 years or more; 'our current ground water withdrawal levels are so dangerous that "We are essentially borrowing on tomorrow's future. We'll pay that price over time," says the director of the CA Department of Water Resources.

OO Not Just California: Droughts Extend Across Americas - a dry spell has killed cattle and wiped out crops in Central America; parts of Colombia are rioting over scarce water, and southern Brazil is facing its worst dry spell in 50 years.

2014-10-20-cyclonelossesby2090abycountryclimatecentralccr247.jpg
Via Climate Central

OO Cyclones Under Climate Change to Cost World $10 TRILLION by 2090 - if the prediction of fewer but stronger cyclones hold under worsening climate change. Most climate change predictions tend to underestimate emerging problems, though....

2014-10-20-Englandsabnormalhirainfallviaclimatecentralccr247.jpg
Extreme rainfall that caused flooding in England is just one of many extreme weather events that scientists could be exploring as a possible tie to climate change for the upcoming supplement to the Bulletin of the American Meteorological Society.

OO 2014 Extreme Weather: Looking for Climate Ties

2014-10-20-floodingMiamiflooding41313wildwxatwildwxcomccr227.jpg
Wild wx at wildwx.com

Sea Level Rise Making Floods Routine for US Coastal Cities reports John Upton at Climate Central. East coast city tidal floods could triple by 2030 for some, says a new report, and increase 10 times by 2045.

OO Picture This: Monster Typhoon and Miami's King Tides

2014-10-20-coffeecupofwikipediacctw96.jpg
Wikipedia

OO Price of Coffee Beans Soar To 2½-Year High nearly doubling this year, with thin rainfall clipping output from the world's biggest coffee grower and fueling worries about how already-weakened trees will fare next season.

OO Zimbabwe: Climate Change Hits Banana Farmers

KEEPING CARBON STORED: FORESTS UPDATE
Forests: the cheapest way to store carbon


Julia Roberts is Mother Nature; see other hard hitting voices of nature here.

OO Next Big Idea In Forest Conservation? Empower Youth Leaders

2014-10-20-forestfragmentationmehccr247.jpg


Forest Fragmentation's Carbon Bomb: 700+ Million Tonnes C02 Annually reports Jeremy Hance at Mongabay. When forests are slashed into fragments, winds dry out the edges leading to dying trees and rising temperatures. Biodiversity often drops, while local extinctions rise and big animals vanish - and carbon emissions rise.

OO Brazil: Needs New Incentives for Ranchers to Keep Cutting Deforestation says new study.

OO Alaska: Summer Heat, Invasive Insects Cutting Down Birch Trees

OO Borneo: Indonesia To Set Up Palm Oil Monitoring In Bid To Cut Deforestation 80%

There is, of course, much more news on the consequences and solutions to climate change. To get it, check out this annotated resource list I've compiled, "Climate Change News Resources," , at Wordpress.com here. For more information on the science of climate change, its consequences and solutions you can view my annotated list of online information resources here.

To help you understand just what science does and does NOT do, check this out!

Every day is Earth Day, folks, as I was reminded by this daisy I photographed in the African wilderness recently. Making the U.S. a global clean energy leader will ensure a heck of a lot more jobs, and a clean, safe future. If you'd like to join the increasing numbers of people who want to TELL Congress that they will vote for clean energy candidates you can do so here. It's our way of letting Congress know there's a strong clean energy voting bloc out there. For more detailed summaries of the above and other climate change items, audio podcasts and texts are freely available.

Read Post